Recombinant Mycoplasma pneumoniae Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; MPN_269; A65_orf493; MP564; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
rny
Target Protein Sequence
MSAKLTLESIAKTFAETSIFAILFLIIVILNLGLLVFLAYQYRVYKKKQRANLTKQTYNN DYGQIVNLKQQNGAKIKELANLKDQLSELGQKFNTTLSEIINKPLVNVIDEYLDEQFKQA ANFREAELNAVLDSNDQKTVFHKRLFNKFHFGVDKLANINVKNPLNLCWVDSASFTVIES DFRKLNGVGGINKKLLIEKLRIEDIIFTNIDKKYYEVQILSDSPVKVQKTVLTIRNILIN DYVDNEKIESYAREANGYFNDHCKLIGKQVLERLNIFEISPKLHKFFGLLAFRYSFGQNV LSHCLETGFLTAYLALLVNFKPDVALKCGLYHDIGKADDENGKKNHTVTGAKIGDEFYFE NDVKYTIANHHNKNVDNVYCRLTQIGDKLSAGRLGARSDSSVLFSQLKQELKQIVEETLA QFKTTILLGQSGRRLVIWLETNQHNNIIDNQQLTDLATTIKSKIVQNNITNRFPIKVVLR YNFEHSFDTKDKN
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links

KEGG: mpn:MPN269

Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y (RNase Y) in Mycoplasma pneumoniae?

Ribonuclease Y (RNase Y) in Mycoplasma pneumoniae is an essential endoribonuclease encoded by the rny gene (MPN_269), functioning as a membrane-bound protein involved in RNA processing and decay. The full-length protein consists of 493 amino acids with an N-terminal membrane anchor followed by functional domains responsible for RNA recognition and cleavage . Unlike some other bacterial RNases, RNase Y typically initiates RNA decay through endonucleolytic cleavage, which is often the rate-limiting step in the RNA degradation pathway. In M. pneumoniae, which has undergone extensive genome reduction during evolution, RNase Y likely serves multiple essential functions in RNA metabolism due to the limited number of RNases in this organism compared to other bacteria with larger genomes.

RNase Y belongs to a class of enzymes that play crucial roles in post-transcriptional gene regulation by controlling mRNA stability and processing. Its activity directly influences the half-life of various transcripts, allowing bacteria to rapidly adjust gene expression in response to changing environmental conditions. Given the minimal genome of M. pneumoniae, the functions of RNase Y may be particularly critical since there is less redundancy in RNA processing pathways. This enzyme likely coordinates with other components of the RNA degradation machinery to ensure proper regulation of gene expression.

How is RNase Y structurally characterized in Mycoplasma pneumoniae?

RNase Y in Mycoplasma pneumoniae features a modular domain organization typical of this class of RNases, with the 493-amino acid protein divided into distinct functional regions. The N-terminal transmembrane domain (approximately residues 1-25) is characterized by hydrophobic amino acids that anchor the protein to the bacterial membrane, as evidenced by the sequence "MSAKLTLESIAKTFAETSIFAILFLIIVILNLGLLVFLAYQYRVYK..." . Following this membrane anchor, the protein likely contains a KH (K homology) domain that functions as an RNA-binding module recognizing specific RNA sequences. The catalytic core of the enzyme is expected to contain an HD domain housing the active site responsible for the endonucleolytic cleavage of RNA substrates.

What is the function of RNase Y in bacterial RNA metabolism?

RNase Y serves as a pivotal enzyme in bacterial RNA metabolism, primarily as an endonuclease that initiates the decay of numerous RNA transcripts by making internal cuts within transcripts, creating entry points for other ribonucleases to complete the degradation process . It plays a key role in the processing of complex RNA substrates, including polycistronic mRNAs, which are common in bacterial genomes . In several Gram-positive bacteria, RNase Y has been shown to regulate the expression of virulence factors and other important proteins, as demonstrated in Streptococcus pyogenes, where it is required for the expression of the streptococcal pyrogenic exotoxin B (SpeB) .

Research indicates that RNase Y preferentially cleaves downstream of guanosine (G) residues, as demonstrated in S. pyogenes, which likely contributes to its targeting specificity . In Bacillus subtilis, RNase Y moves rapidly along the membrane in the form of dynamic short-lived foci, suggesting a mechanism for regulating its activity through spatial organization . The RNA degradation process initiated by RNase Y is intricately connected to translation and transcription, allowing bacteria to rapidly adjust gene expression in response to changing environmental conditions. This enzyme therefore sits at a critical junction in bacterial gene expression, influencing both the quality and quantity of proteins produced.

How does RNase Y in M. pneumoniae compare to similar enzymes in other bacteria?

RNase Y in Mycoplasma pneumoniae shares functional similarities with counterparts in other bacteria, but exhibits several notable differences in its characteristics and behavior. While M. pneumoniae RNase Y is membrane-anchored like its counterparts in B. subtilis and S. pneumoniae, the dynamics of its membrane association may differ . In B. subtilis, RNase Y forms dynamic foci that increase following transcription arrest, which contrasts with RNase E in E. coli (a functional equivalent in Gram-negative bacteria), where foci formation depends on the presence of RNA substrates .

The impact of RNase Y deletion varies across bacterial species, with S. pneumoniae deletion mutants showing defects in cell morphology and growth in vitro as well as strong attenuation of virulence . The substrate specificity also appears to differ, with B. subtilis RNase Y known to cleave complex substrates like polycistronic mRNAs efficiently . Regulatory complexes also vary, with B. subtilis featuring a "Y-complex" that affects the assembly status and efficiency of RNase Y, shifting it toward fewer and smaller complexes to increase cleavage efficiency .

These differences likely reflect adaptations to the specific cellular environments and regulatory networks of each bacterial species. For M. pneumoniae, with its highly reduced genome, RNase Y may have evolved specialized functions or regulatory mechanisms not seen in bacteria with larger genomes. Understanding these species-specific adaptations is crucial for developing targeted approaches to studying and potentially manipulating RNase Y activity in different bacteria.

What is the subcellular localization of RNase Y in Mycoplasma pneumoniae?

Based on the amino acid sequence data, Mycoplasma pneumoniae RNase Y contains an N-terminal hydrophobic region consistent with a membrane-anchoring domain: "MSAKLTLESIAKTFAETSIFAILFLIIVILNLGLLVFLAYQYRVYK..." . This strongly suggests that RNase Y in M. pneumoniae is membrane-localized, similar to its counterparts in other Gram-positive bacteria. While specific experimental evidence for M. pneumoniae RNase Y localization is not directly provided in the search results, studies in related organisms like Bacillus subtilis show that RNase Y is anchored to the inner cell membrane, where it moves rapidly in the form of dynamic short-lived foci .

The membrane localization of RNase Y likely serves several important functions in the cell. First, it enables spatial coupling of RNA degradation with translation, which primarily occurs at the cell periphery, allowing for coordinated regulation of these processes. Second, membrane localization facilitates co-localization with other membrane-bound components of the RNA degradation machinery, potentially forming functional complexes. Finally, this compartmentalization may serve as a regulatory mechanism by controlling which RNA substrates have access to the enzyme.

For definitive determination of M. pneumoniae RNase Y localization, techniques such as fluorescence microscopy using GFP-tagged RNase Y constructs or immunofluorescence with anti-RNase Y antibodies would be appropriate experimental approaches. Such studies would provide valuable insights into the dynamic behavior of RNase Y in the context of M. pneumoniae's unique cell architecture and minimal genome.

What experimental approaches are best suited for studying RNase Y activity in M. pneumoniae?

Several complementary experimental approaches can be employed to comprehensively investigate RNase Y activity in Mycoplasma pneumoniae. In vitro RNA cleavage assays using purified recombinant RNase Y with synthetic or in vitro transcribed RNA substrates can identify specific cleavage sites through gel electrophoresis or high-throughput sequencing, similar to approaches used with RNase Y from S. pyogenes to identify cleavage sites downstream of guanosine residues . Genetic manipulation approaches, including construction of conditional rny mutants (as complete deletion may be lethal), site-directed mutagenesis of catalytic residues, or CRISPR interference (CRISPRi) for tunable gene repression, can reveal the functional importance of RNase Y in vivo.

Transcriptome-wide analyses such as RNA-seq comparing wild-type and RNase Y-depleted strains can identify affected transcripts, while PARE (Parallel Analysis of RNA Ends) or similar methods can map cleavage sites genome-wide, as similar approaches in S. pneumoniae revealed that RNase Y affects transcripts involved in cell division, metabolism, stress response, and virulence . Protein-RNA interaction studies including RNA immunoprecipitation (RIP), CLIP-seq (Cross-linking immunoprecipitation followed by sequencing), or bacterial three-hybrid assays can identify direct RNA targets and map binding sites with nucleotide resolution.

Visualization techniques using fluorescence microscopy with fluorescent protein fusions can reveal RNase Y localization patterns, while proteomic approaches such as co-immunoprecipitation, bacterial two-hybrid screens, or cross-linking mass spectrometry can identify protein interaction partners and interfaces. When designing these experiments, researchers should consider the challenges specific to M. pneumoniae, including its minimal genome, fastidious growth requirements, and the limited availability of genetic tools compared to model organisms.

How do repetitive elements in the M. pneumoniae genome affect RNase Y function?

The relationship between M. pneumoniae repetitive elements and RNase Y function represents an intriguing area for investigation, as M. pneumoniae contains numerous copies of four distinct large repetitive elements (RepMPs) . These repetitive elements create complex RNA secondary structures that may affect RNase Y recognition and cleavage efficiency, potentially presenting unique substrates for RNase Y processing. RNase Y might differentially process transcripts containing different RepMP variants, which could create a post-transcriptional regulatory mechanism linked to the RepMP recombination system that generates sequence variations in clinical strains .

If RNase Y targets sequences within or adjacent to RepMP elements, variations through recombination events could alter RNA processing and degradation patterns, potentially representing an adaptive mechanism for M. pneumoniae to regulate gene expression during host infection. The distribution of RepMP elements could create differential susceptibility to RNase Y degradation if the enzyme has sequence preferences (like the G-residue preference noted in S. pyogenes ), introducing heterogeneity in transcript stability across the genome.

A particularly interesting example is the P1 operon, which contains copies of RepMP2/3, RepMP4, and RepMP5 that undergo recombination events to generate sequence diversity in adhesin proteins critical for virulence . If RNase Y processes transcripts from this operon, it could serve as a post-transcriptional regulator of adhesin expression and thereby influence virulence. Experimental approaches to investigate this relationship could include comparing RNase Y cleavage patterns in regions containing different RepMP variants, analyzing how RepMP recombination events affect transcript stability, and examining whether RNase Y activity influences the frequency of RepMP recombination events.

How does the membrane localization of RNase Y influence its function in M. pneumoniae?

The membrane localization of RNase Y, indicated by its N-terminal hydrophobic domain , has profound implications for its function in M. pneumoniae through multiple mechanisms. This localization positions RNase Y near ribosomes engaged in co-translational mRNA degradation, allowing for efficient coupling between translation termination and mRNA degradation, which as noted in search result , creates a "pseudocompartmentalization [that] appears coherent with translation occurring primarily at the cell periphery" . The dynamic nature of RNase Y distribution, as seen in B. subtilis where it forms "dynamic short-lived foci" that move rapidly along the membrane and become "more abundant and increase in size following transcription arrest" , suggests that clustering of RNase Y might regulate its activity by creating zones of concentrated RNA degradation.

Membrane localization facilitates interactions with other membrane-bound components of RNA metabolism, which in the minimal genome of M. pneumoniae may be especially important for coordinating various cellular processes. Positioning at the membrane provides RNase Y with access to nascent transcripts emerging from membrane-associated RNA polymerase, potentially allowing immediate processing of certain transcripts before they engage with ribosomes. Additionally, the unique aspects of M. pneumoniae as a wall-less bacterium with minimal genome might make membrane localization particularly important for organizing cellular processes, with membrane-bound RNase Y potentially being differentially distributed across specialized cellular structures.

Experimental visualization of RNase Y localization specifically in M. pneumoniae would be necessary to confirm these hypotheses derived from studies in other organisms. Such studies could employ fluorescently tagged RNase Y variants to observe its dynamic behavior in living cells, potentially revealing unique aspects of its function in the context of M. pneumoniae's specialized cellular architecture and lifestyle as a minimal-genome pathogen.

What role does RNase Y play in M. pneumoniae pathogenesis?

While direct evidence for RNase Y's role in M. pneumoniae pathogenesis is not provided in the search results, findings from related respiratory pathogens strongly suggest its importance. In Streptococcus pneumoniae, "RNase Y and PNPase are essential for pneumococcal pathogenesis, as both deletion mutants showed strong attenuation of virulence in murine models" , indicating that RNase Y likely plays a critical role in the virulence of respiratory pathogens like M. pneumoniae. RNase Y has been shown to regulate virulence factor expression in several Gram-positive pathogens, including Streptococcus pyogenes, where "RNase Y is required for the expression of the major secreted virulence factor streptococcal pyrogenic exotoxin B (SpeB)" , suggesting M. pneumoniae likely uses RNase Y to regulate the expression of its own virulence factors.

The ability to rapidly adjust gene expression during infection through RNase Y-mediated RNA turnover provides a mechanism for quick adaptation to changing host conditions, which would be particularly important for M. pneumoniae during respiratory tract colonization. M. pneumoniae pathogenesis depends heavily on adhesins like P1, and the search results indicate that the P1 operon contains RepMP elements that undergo recombination to generate sequence diversity , suggesting that RNase Y could potentially regulate the expression of these adhesin genes post-transcriptionally. Additionally, RNase Y likely regulates stress response pathways that are essential for survival in the host, as infection subjects bacteria to various stresses (oxidative, nutritional, immune).

While these connections are plausible based on RNase Y's functions in other pathogens, experimental verification in M. pneumoniae would require approaches such as virulence studies with RNase Y conditional mutants, transcriptome analysis during infection conditions, and identification of RNase Y-dependent virulence factors. Such studies would provide valuable insights into the mechanisms by which this minimal genome pathogen coordinates gene expression during infection.

How can recombinant M. pneumoniae RNase Y be optimally expressed and purified for functional studies?

Based on the biochemical properties indicated in the search results and general principles of membrane-associated RNases, optimal expression and purification of functional recombinant M. pneumoniae RNase Y requires careful consideration of several factors. For expression system selection, E. coli-based expression using BL21(DE3) or C41/C43(DE3) strains (the latter specialized for membrane proteins) with a T7 promoter system with tight regulation (pET series vectors) would be appropriate, potentially using a codon-optimized synthetic gene to account for M. pneumoniae's unusual codon usage. Protein engineering considerations should include either an N-terminal truncation to remove the transmembrane domain (approximately first 25 amino acids) to improve solubility or the use of solubilization tags like MBP (maltose-binding protein) or SUMO, along with a cleavable affinity tag (His6, FLAG, or Strep-tag) for purification.

The expression protocol should include culture growth at lower temperature (16-20°C) after induction, lower IPTG concentrations (0.1-0.5 mM) to slow expression rate, 1% glucose addition to media to prevent leaky expression, and protease inhibitors in growth media to prevent degradation. For full-length membrane-bound RNase Y, the purification strategy should involve gentle cell lysis preserving membrane integrity, membrane fraction isolation by ultracentrifugation, solubilization using mild detergents (e.g., DDM, LMNG, or digitonin), and affinity chromatography in the presence of detergent followed by size exclusion chromatography to remove aggregates.

Quality control should include activity assays using synthetic RNA substrates, verification of oligomeric state by size exclusion chromatography, thermal stability assessment by differential scanning fluorimetry, and RNA binding verification by electrophoretic mobility shift assay. Based on search result , appropriate storage conditions would include a "Tris-based buffer, 50% glycerol, optimized for this protein" , storage at "-20°C, for extended storage, conserve at -20°C or -80°C" , avoiding "repeated freezing and thawing" , and keeping working aliquots "at 4°C for up to one week" .

What are the specific cleavage sites of RNase Y in Mycoplasma pneumoniae transcripts?

While the search results don't provide direct experimental data on specific cleavage sites of RNase Y in M. pneumoniae transcripts, studies of RNase Y in related bacteria offer valuable insights into their likely characteristics. In Streptococcus pyogenes, RNase Y cleaves sites "located downstream of a guanosine (G) residue" , with mutagenesis studies demonstrating "that the presence of this G residue is essential for the processing" by RNase Y , suggesting M. pneumoniae RNase Y may have similar G-dependency in its cleavage sites. Beyond sequence specificity, RNase Y likely recognizes specific RNA structural features, with potential cleavage sites found in single-stranded regions adjacent to structured elements, such as loop regions in stem-loops or bulges in RNA helices.

Based on what's known in other bacteria, likely targets in M. pneumoniae include transcripts encoding virulence factors, metabolic enzyme mRNAs requiring rapid regulation, polycistronic operons requiring processing, and stress response transcripts. To experimentally identify M. pneumoniae RNase Y cleavage sites, genome-wide approaches such as RNA-seq comparing wild-type and RNase Y-depleted strains, PARE-seq (Parallel Analysis of RNA Ends) to map 5' ends generated by cleavage, and Term-seq to identify termini generated by RNase activity would be valuable.

Targeted approaches including in vitro cleavage assays with purified RNase Y and candidate RNA substrates, primer extension analysis to map cleavage sites with nucleotide precision, and structure probing of target RNAs to correlate cleavage with structural features would complement the global analyses. A systematic mapping of cleavage sites would provide insights into the regulatory networks controlled by RNase Y in M. pneumoniae and potentially reveal specialized functions unique to this minimal genome pathogen, particularly in relation to its adaptation to the human respiratory tract environment.

How do mutations in the rny gene affect M. pneumoniae virulence and metabolism?

While direct experimental evidence for the effects of rny mutations specifically in M. pneumoniae is not provided in the search results, findings from related organisms allow for informed predictions. Based on observations in Streptococcus pneumoniae, where RNase Y deletion mutants showed "strong attenuation of virulence in murine models" , mutations in M. pneumoniae rny would likely reduce virulence, potentially affecting adhesion to respiratory epithelium (if RNase Y regulates adhesin expression), inflammatory response induction, and survival under host immune pressure. Metabolically, RNase Y deletion in S. pneumoniae resulted in "pleiotropic phenotypes" , and in B. subtilis, RNase Y affects processing of complex substrates like polycistronic mRNAs , suggesting that mutations might alter carbon metabolism, disrupt energy production, create imbalanced nucleotide pools, and dysregulate stress responses.

Growth and morphology would likely be affected, as in S. pneumoniae, where lack of RNase Y resulted in "defects in pneumococcal cell morphology and growth in vitro" , suggesting M. pneumoniae might show slower growth rates, altered cell morphology, and defects in cell division. Gene expression changes would be widespread, as RNase Y has a "global impact on gene expression, altering levels of transcripts involved in diverse cellular processes" in S. pneumoniae, indicating M. pneumoniae rny mutations would likely cause extensive transcriptome changes, altered protein synthesis rates, and dysregulation of regulatory RNAs.

Given the reduced genome of M. pneumoniae and its dependence on host resources, the effects of rny mutations might be even more profound than in bacteria with larger genomes and more redundant systems. Experimental approaches to investigate these effects could include conditional knockdown of rny (since complete deletion may be lethal), transcriptome analysis comparing wild-type and mutant strains, metabolomic profiling to detect changes in metabolite pools, infection models to assess virulence attenuation, and site-directed mutagenesis to examine the function of specific RNase Y domains.

What techniques can be used to study RNase Y-dependent RNA degradation in real-time?

Several advanced techniques can be employed to study RNase Y-dependent RNA degradation in real-time, providing valuable insights into the kinetics and mechanisms of this essential process. Fluorescence-based in vitro assays offer powerful approaches, including FRET-based reporter substrates where RNA substrates are dual-labeled with fluorophore-quencher pairs so that cleavage by RNase Y separates the fluorophore from the quencher, increasing fluorescence and allowing continuous monitoring of cleavage kinetics. Similarly, molecular beacons utilizing self-complementary RNA probes that form hairpin structures can detect fluorescence changes upon RNase Y-mediated structural alterations, and can be designed to monitor specific cleavage events.

In vivo RNA tracking systems provide complementary approaches for studying degradation in living cells. The MS2-GFP system, where target RNAs are tagged with MS2 binding sites and an MS2-GFP fusion protein binds these sites to make the RNA fluorescent, allows RNase Y-mediated degradation to be visualized as a loss of fluorescence through time-lapse microscopy. Alternative approaches using Spinach/Broccoli RNA aptamers that bind fluorophores like DFHBI can be less perturbative while still enabling real-time monitoring of RNA stability.

Single-molecule approaches offer unprecedented resolution, with TIRF microscopy of surface-immobilized RNAs labeled with fluorophores allowing observation of individual cleavage events upon addition of purified RNase Y, providing insights into cleavage rates and processivity. Biochemical approaches with temporal resolution, such as quench-flow kinetics with rapid mixing of RNase Y with RNA substrates and reaction quenching at millisecond time points, enable analysis of degradation intermediates by gel electrophoresis. Time-resolved structure probing, where structure probing reagents are applied at different time points during degradation, can reveal structural changes during RNase Y processing and identify transient intermediates.

How does RNase Y interact with other components of the RNA degradosome in M. pneumoniae?

The concept of an RNA degradosome - a multiprotein complex involved in coordinated RNA degradation - has been well established in various bacteria, and understanding RNase Y interactions in M. pneumoniae would provide valuable insights into RNA metabolism in this minimal genome pathogen. Based on known interactions in other Gram-positive bacteria, potential RNase Y interaction partners might include Polynucleotide phosphorylase (PNPase), a 3'-5' exoribonuclease that degrades RNA fragments, which in S. pneumoniae works alongside RNase Y as both are "essential for pneumococcal pathogenesis" . Additional partners might include RNA helicases that unwind structured RNA to facilitate degradation, Ribonuclease J1/J2 (if present in M. pneumoniae) providing additional endo- and exoribonuclease activities, and potentially glycolytic enzymes that in B. subtilis associate with RNA degradation machinery to couple metabolic state with RNA turnover.

The "Y-complex" concept mentioned in search result for B. subtilis "shifts the assembly status of RNase Y toward fewer and smaller complexes" , has "an effect similar to but much stronger than that of depletion of RNA" , and increases "cleavage efficiency of complex substrates like polycistronic mRNAs" . This suggests that protein-protein interactions modulate RNase Y activity, potentially through controlling its oligomerization state. RNase Y's membrane localization may facilitate interactions with other membrane-associated proteins, potentially creating specialized membrane microdomains for RNA processing, with the dynamic foci observed for RNase Y in B. subtilis possibly representing transient degradosome assemblies.

From a comparative genomics perspective, M. pneumoniae has undergone extensive genome reduction, suggesting some typical degradosome components may be absent, and RNase Y might have evolved additional functions or interaction capabilities to compensate for the streamlined genome. Experimental approaches to identify these interactions could include co-immunoprecipitation to pull down RNase Y and analyze associated proteins, bacterial two-hybrid systems for systematic testing of potential interaction partners, proximity labeling techniques like BioID for in vivo labeling of proteins near RNase Y, and structural approaches such as cryo-electron tomography or crosslinking mass spectrometry to visualize complexes and identify interaction interfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.