Recombinant Mycoplasma pneumoniae Uncharacterized protein MG028 homolog (MPN_031)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_031; B01_orf203; MP123; Uncharacterized protein MG028 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_031
Target Protein Sequence
MRRNWREHYNVFVANLALVLGFMLNIVVARYTLTGATPQARFLFLTPFLGIVAASIFYFF DVKWFLADYPYKKFHFQKKWTWTYLSGVFVFFANILVNVILLALLVNQMTNQILSEKYTG LLDNAYPLLWSAVGVSIFLSLISIGLSKTAHFKIDVEMLKAKKGEPTAADKTDSRPVVVD LDQTKSKKDGDNPPQASGDMTSL
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN031

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about the MPN_031 protein in Mycoplasma pneumoniae?

MPN_031 is an uncharacterized protein in Mycoplasma pneumoniae that has sequence homology to the MG028 protein in Mycoplasma genitalium. While specific functional characterization is still ongoing, it likely plays a role in the DNA recombination machinery of M. pneumoniae, similar to other conserved proteins that have been identified in this organism. M. pneumoniae has relatively small genomes (816 kb) with a significant portion consisting of repeated DNA elements called RepMP elements that are involved in antigenic variation through homologous recombination . The homologous recombination machinery in Mycoplasma species includes several core proteins whose activities have been investigated, including RuvA, single-stranded DNA-binding protein (SSB), RecA, and RecU . MPN_031 may function within this broader recombination network.

How should researchers approach the expression and purification of recombinant MPN_031?

The expression and purification of recombinant MPN_031 should follow a systematic approach:

What bioinformatic tools can help predict the function of uncharacterized proteins like MPN_031?

For uncharacterized proteins like MPN_031, a multi-tool bioinformatic approach is recommended:

  • Sequence homology analysis: Use BLASTP, FASTA, or HMMER to identify homologous proteins with known functions in other organisms.

  • Domain and motif identification: Analyze the protein sequence using InterProScan, SMART, or Pfam to identify conserved domains or motifs that might suggest function.

  • Structural prediction: Utilize AlphaFold2, I-TASSER, or SWISS-MODEL to predict the 3D structure, which may provide functional insights based on structural similarities.

  • Genomic context analysis: Examine the genomic neighborhood of MPN_031 to identify potential operons or functionally related genes.

  • Phylogenetic analysis: Construct phylogenetic trees to understand evolutionary relationships with characterized proteins from other species.

  • Protein-protein interaction prediction: Use tools like STRING or PSICQUIC to predict potential interaction partners.

These computational analyses should be followed by experimental validation to confirm predicted functions.

What experimental design approach is most effective for optimizing recombinant MPN_031 expression?

A multivariant statistical experimental design is significantly more effective than the traditional univariant approach for optimizing MPN_031 expression. This approach allows for:

  • Simultaneous evaluation of multiple variables: Assess the effects of multiple factors (media composition, induction conditions, etc.) on protein expression in a single experimental design.

  • Identification of statistically significant variables: Determine which variables have the greatest impact on protein expression, biological activity, and productivity.

  • Detection of interaction effects: Identify how different variables interact with each other to influence expression outcomes.

  • Characterization of experimental error: Quantify and account for experimental variability.

  • Efficient experimental workflow: Gather high-quality information with fewer experiments than traditional one-variable-at-a-time approaches .

A fractional factorial design (such as 2^8-4) with center point replicates is particularly effective, allowing researchers to screen 8 variables at two levels each, as demonstrated for other recombinant proteins . The following table illustrates the types of variables and their effects that might be examined:

VariableEffect on Cell Growth (p-value)Effect on Protein Activity (p-value)Effect on Process Productivity (p-value)
Induction absorbanceSignificant (<0.0001)Significant (0.0016)Not significant (0.2248)
IPTG concentrationSignificant (0.0387)Not significant (0.5422)Not significant (0.4720)
Expression temperatureSignificant (<0.0001)Significant (0.0011)Significant (0.0041)
Yeast extractSignificant (0.0004)Not significant (0.3706)Not significant (0.3930)
TryptoneSignificant (0.0027)Significant (0.0061)Significant (0.0095)
GlucoseNot significant (0.0920)Not significant (0.0685)Not significant (0.1797)

This approach will help identify the optimal conditions for maximizing MPN_031 expression in its soluble, functional form .

How can researchers troubleshoot low solubility issues with recombinant MPN_031?

When facing low solubility of recombinant MPN_031, a systematic troubleshooting approach should be implemented:

  • Optimize expression temperature: Lower temperatures (15-25°C) often promote proper folding and increase solubility. Expression temperature has been shown to significantly affect both cell growth and protein activity in recombinant systems .

  • Modify induction parameters: Adjust IPTG concentration and induction cell density (absorbance). High IPTG concentrations can lead to rapid protein expression that overwhelms the folding machinery, while optimal induction absorbance ensures cells are in the appropriate growth phase for protein expression .

  • Evaluate co-expression with chaperones: Co-express MPN_031 with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist with proper folding.

  • Test fusion tags: Express MPN_031 with solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin.

  • Optimize media composition: Adjust the concentrations of yeast extract, tryptone, and carbon sources, which have been shown to significantly affect recombinant protein expression and activity .

  • Consider lysis buffer optimization: Test various buffer compositions, salt concentrations, and additives (glycerol, detergents, arginine) during cell lysis to improve solubility.

  • Implement refolding strategies: If inclusion bodies persist, develop a refolding protocol from denatured protein using gradual dilution or dialysis methods.

Monitoring each intervention with quantitative solubility assays will help identify the most effective approaches for your specific protein.

What analytical methods are most effective for characterizing the structure and function of MPN_031?

Comprehensive characterization of MPN_031 requires a multi-technique approach:

How can researchers investigate if MPN_031 is involved in DNA recombination machinery similar to other Mycoplasma proteins?

To investigate if MPN_031 functions in DNA recombination machinery like other characterized Mycoplasma proteins:

  • Sequence and structural analysis:

    • Examine MPN_031 for conserved motifs found in recombination proteins, such as Walker A and B motifs, and sensor I and II motifs that are characteristic of AAA+ protein superfamily members, as seen in RuvB proteins

    • Compare MPN_031 sequence with known recombination proteins from Mycoplasma species and other bacteria

  • DNA binding and processing assays:

    • Test DNA binding ability using gel shift assays with various DNA substrates (single-stranded, double-stranded, Holliday junction structures)

    • Assess ATP-dependent and divalent cation-dependent DNA helicase activity on partially double-stranded DNA substrates

    • Examine Holliday junction resolution or branch migration activities

  • Protein interaction studies:

    • Identify potential interaction partners using pull-down assays or co-immunoprecipitation

    • Test specific interactions with known recombination proteins such as RuvA, RecA, or SSB from M. pneumoniae

    • Perform yeast two-hybrid or bacterial two-hybrid screens to discover novel interaction partners

  • Functional complementation:

    • Express MPN_031 in E. coli strains deficient in specific recombination proteins

    • Assess whether MPN_031 can complement the deficiency by restoring recombination proficiency

  • In vivo recombination assays:

    • Develop assays to measure homologous recombination frequency in M. pneumoniae

    • Compare recombination rates between wild-type and MPN_031 mutant strains

    • Analyze the effect of MPN_031 overexpression on recombination frequency

Similar to studies on RuvB proteins from M. pneumoniae, these approaches can reveal whether MPN_031 possesses ATPase activity, DNA binding capability, and helicase activity, which would suggest a role in DNA recombination processes .

What are the optimal conditions for high-yield soluble expression of MPN_031 in E. coli?

Based on experimental design approaches used for similar recombinant proteins, the following conditions typically yield high levels of soluble protein expression:

  • Host strain selection:

    • BL21(DE3) or derivatives like BL21(DE3)pLysS for tight expression control

    • Rosetta or CodonPlus strains if codon bias is a concern for Mycoplasma proteins

  • Expression vector:

    • pET series vectors (e.g., pET-11c) with T7 promoter system for high-level expression

    • Consider adding solubility-enhancing tags (His6, MBP, SUMO) with appropriate protease cleavage sites

  • Culture conditions:

    • Rich media containing optimal concentrations of tryptone (significant effect on protein activity and process productivity, p=0.0061 and p=0.0095, respectively)

    • Appropriate yeast extract concentration (significant effect on cell growth, p=0.0004)

    • Controlled carbon source (glucose or glycerol depending on protein characteristics)

  • Induction parameters:

    • Induction at optimal cell density (OD600 of 0.6-0.8 is often a good starting point)

    • Moderate IPTG concentration (0.1-0.5 mM) to prevent overwhelming cellular machinery

    • Reduced expression temperature (16-25°C) to promote proper folding

    • Expression time of 4-6 hours for optimal productivity

  • Buffer conditions:

    • Lysis buffer containing appropriate salts (150-300 mM NaCl)

    • Stabilizing agents (5-10% glycerol)

    • Mild detergents if needed (0.1% Triton X-100)

    • Protease inhibitors to prevent degradation

Following this framework and applying systematic optimization through factorial experimental design can achieve soluble expression levels up to 250 mg/L, similar to what has been accomplished with other recombinant proteins .

What purification strategy is most effective for obtaining high-purity recombinant MPN_031?

A multi-step purification strategy is recommended for obtaining high-purity MPN_031:

  • Initial capture step:

    • If tagged, use affinity chromatography (IMAC for His-tag, amylose for MBP-tag)

    • If untagged, consider ion exchange chromatography based on the theoretical pI of MPN_031

  • Intermediate purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates and remove high molecular weight contaminants

    • Ion exchange chromatography (if not used as capture step) to remove proteins with different charge properties

  • Polishing step:

    • Hydrophobic interaction chromatography to remove remaining contaminants based on surface hydrophobicity differences

    • Second size exclusion step under optimized buffer conditions for final purity

  • Tag removal (if applicable):

    • Specific protease cleavage (e.g., TEV, PreScission, SUMO protease)

    • Reverse affinity chromatography to remove the cleaved tag

    • Size exclusion chromatography to separate the target protein from the protease

  • Quality control assessments:

    • SDS-PAGE and western blotting to verify purity and identity

    • Mass spectrometry to confirm protein mass and integrity

    • Dynamic light scattering to assess monodispersity

    • Activity assays to confirm functional integrity

This multi-step approach can achieve approximately 75% homogeneity while maintaining the functional activity of the protein, as demonstrated with other recombinant proteins from bacterial sources .

How can researchers determine if strain-specific variations in MPN_031 affect its function, similar to what has been observed with RuvB proteins?

To investigate strain-specific variations in MPN_031 and their functional implications:

  • Sequence comparison across strains:

    • Obtain and align MPN_031 sequences from different M. pneumoniae strains (such as subtype 1 and subtype 2 strains)

    • Identify single amino acid polymorphisms or other variations, similar to the position 140 variation observed in RuvB proteins

  • Expression and purification of variants:

    • Express and purify MPN_031 from multiple M. pneumoniae strains

    • Ensure identical expression and purification protocols to allow direct comparisons

  • Comparative functional assays:

    • Perform side-by-side functional assays (enzymatic activity, DNA binding, protein interaction)

    • Measure and compare kinetic parameters (Km, kcat, binding affinities)

    • Assess DNA-unwinding activity if MPN_031 shows helicase function, as significant differences were observed between RuvB variants from different M. pneumoniae strains

  • Structural analysis of variants:

    • Obtain crystal structures or structural models of different MPN_031 variants

    • Analyze how amino acid changes affect protein folding, active site geometry, or surface properties

  • In vivo complementation studies:

    • Express different MPN_031 variants in the same genetic background

    • Assess their ability to complement functional deficiencies

    • Measure differences in phenotypic outcomes

This approach will reveal whether MPN_031, like RuvB, exhibits strain-specific functional differences that could impact DNA recombination processes in different M. pneumoniae strains. For RuvB, even a single amino acid difference (position 140) between strains resulted in significantly different DNA-unwinding activities .

What strategies can researchers use to validate predicted functions of MPN_031?

To validate predicted functions of the uncharacterized MPN_031 protein:

  • Gene knockout or knockdown:

    • Create MPN_031 deletion mutants in M. pneumoniae if genetic tools are available

    • Use CRISPR-Cas9 or transposon mutagenesis approaches

    • Characterize phenotypic changes in growth, morphology, or specific cellular processes

  • Complementation studies:

    • Reintroduce wild-type or mutated MPN_031 into knockout strains

    • Test ability to restore wild-type phenotype

    • Express MPN_031 in heterologous systems deficient in proteins with similar predicted functions

  • Structure-function analysis:

    • Generate site-directed mutants of key residues predicted to be important for function

    • Analyze effects of mutations on biochemical activities and in vivo function

    • Create truncation variants to identify functional domains

  • Protein-protein and protein-DNA interaction mapping:

    • Perform co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Use chromatin immunoprecipitation (ChIP) if DNA binding is predicted

    • Validate specific interactions using methods like biolayer interferometry or isothermal titration calorimetry

  • Transcriptomic and proteomic profiling:

    • Compare wild-type and MPN_031 mutant strains to identify affected pathways

    • Integrate data with interaction studies to build functional networks

  • Subcellular localization:

    • Determine where MPN_031 localizes within M. pneumoniae cells

    • Correlate localization with potential functions (e.g., DNA recombination machinery would likely show nucleoid association)

  • Heterologous expression studies:

    • Express MPN_031 in model organisms like E. coli

    • Assess effects on host cell processes related to predicted functions

How can researchers optimize recombinant MPN_031 for structural studies?

Preparing recombinant MPN_031 for structural studies requires specific optimization strategies:

  • Construct optimization:

    • Perform bioinformatic analysis to identify flexible regions or domains

    • Create multiple constructs with different boundaries to increase crystallization chances

    • Remove disordered regions that might hinder crystallization

    • Consider surface entropy reduction mutations (Lys/Glu to Ala) to promote crystal packing

  • Expression optimization for structural studies:

    • Use minimal media for selenomethionine incorporation if phasing by SAD/MAD is planned

    • Consider deuteration for neutron crystallography or NMR studies

    • Optimize expression conditions specifically for isotope labeling (13C, 15N) if NMR studies are planned

  • Purification refinement:

    • Implement additional polishing steps to achieve >95% homogeneity

    • Use size exclusion chromatography as final step to ensure monodispersity

    • Verify protein quality using dynamic light scattering and thermal shift assays

    • Optimize buffer conditions for long-term stability (screen various buffers, pH values, salt concentrations)

  • Crystallization optimization:

    • Perform extensive crystallization screening (1000+ conditions)

    • Optimize promising conditions by varying pH, precipitant concentration, and additives

    • Try different crystallization methods (vapor diffusion, batch, LCP)

    • Consider co-crystallization with binding partners, substrates, or inhibitors

  • Alternative structural approaches:

    • Prepare samples for cryo-EM if crystallization proves challenging

    • Optimize sample concentration, grid preparation, and vitrification conditions

    • Consider NMR for smaller domains if full-length protein is too large

  • Protein engineering for structure determination:

    • Create fusion proteins with well-crystallizing partners (T4 lysozyme, BRIL)

    • Introduce disulfide bonds to stabilize flexible regions

    • Use nanobodies or other crystallization chaperones to promote favorable crystal contacts

What approaches can be used to study the potential role of MPN_031 in antigenic variation through homologous recombination?

To investigate MPN_031's potential role in antigenic variation through homologous recombination:

  • Recombination frequency assays:

    • Develop reporter systems to measure homologous recombination rates between repeated DNA elements in M. pneumoniae

    • Compare recombination frequencies between wild-type and MPN_031 mutant strains

    • Assess the effect of MPN_031 overexpression on recombination rates

  • Analysis of RepMP element variability:

    • Monitor sequence changes in RepMP elements over time in strains with different MPN_031 variants

    • Compare the rate of antigenic variation in P1 protein between strains with functional and non-functional MPN_031

    • Sequence RepMP elements before and after passage under immune selection to detect recombination events

  • In vitro recombination assays:

    • Reconstitute recombination reactions using purified MPN_031 and other recombination proteins

    • Test activity on model DNA substrates mimicking RepMP elements

    • Assess whether MPN_031 can catalyze or facilitate strand exchange or Holliday junction processing

  • Protein interaction studies:

    • Identify interactions between MPN_031 and known recombination proteins (RecA, RuvA, RuvB, SSB)

    • Determine if MPN_031 is part of a larger recombination complex

    • Map the interaction networks of proteins involved in antigenic variation

  • ChIP-seq analysis:

    • Perform chromatin immunoprecipitation followed by sequencing to identify genomic regions bound by MPN_031

    • Determine if MPN_031 preferentially associates with RepMP elements or regions undergoing recombination

  • Structural studies of MPN_031 with DNA:

    • Obtain structures of MPN_031 bound to DNA substrates resembling recombination intermediates

    • Compare binding affinities to different DNA structures (Holliday junctions, D-loops)

This multi-faceted approach will help determine whether MPN_031, like other proteins in the homologous recombination machinery of M. pneumoniae, contributes to the sequence variation of antigenic surface proteins through recombination between repeated DNA elements .

What are the most significant challenges researchers face when working with uncharacterized proteins like MPN_031?

The major challenges researchers face when studying uncharacterized proteins like MPN_031 include:

  • Functional prediction limitations:

    • Low sequence homology to well-characterized proteins

    • Potential for novel or multifunctional roles not easily predicted by bioinformatics

    • Difficulty in selecting appropriate functional assays without prior knowledge

  • Expression and purification obstacles:

    • Optimization of expression conditions without guidance from previous studies

    • Potential toxicity to host expression systems

    • Challenges in obtaining sufficient quantities of soluble, functional protein

    • Development of activity assays without knowing the protein's function

  • Structural characterization difficulties:

    • Crystallization challenges for proteins with flexible regions

    • Structure interpretation without functional context

    • Limited information on physiologically relevant ligands or binding partners

  • Biological context uncertainties:

    • Unclear cellular localization and interaction partners

    • Unknown regulation mechanisms and expression patterns

    • Difficulty developing relevant phenotypic assays for functional validation

  • Technical limitations with Mycoplasma:

    • Limited genetic tools for manipulation of Mycoplasma species

    • Slow growth and specialized culture requirements

    • Challenges in developing in vivo assays for functional validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.