Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068)

Introduction to Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG055 Homolog (MPN_068)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068) is a recombinant protein derived from the bacterium Mycoplasma pneumoniae. This bacterium is known for causing respiratory infections, including pneumonia, and is often associated with atypical pneumonia in humans . The protein MPN_068 is part of a broader category of uncharacterized proteins, which are proteins whose functions have not been fully elucidated. These proteins are often studied for their potential roles in bacterial pathogenesis and as targets for therapeutic interventions.

2.1. Protein Details

• Protein Name: Uncharacterized protein MG055 homolog

• Gene Name: MPN_068

• Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

• UniProt ID: P75048

• Amino Acid Sequence: MEKKKLPFGLKNKEKLTAYNDEKIHELHRQLKAKIEAKKAKEKQDSKTKDTDKKVDQTPK VKVPFTKKFSNLWFGIDKEVNKIVWVTSKKLITIFLLIVLVSAIMIGIYFGINHLFIALG VFKGK

• Expression Region: 1-125 amino acids

3.1. Role in Mycoplasma pneumoniae Pathogenesis

While the specific role of MPN_068 in Mycoplasma pneumoniae pathogenesis is not well understood, proteins like MPN_068 are often studied for their potential involvement in bacterial adherence, immune evasion, and modulation of host cell responses. Mycoplasma pneumoniae uses various proteins to adhere to host cells and evade the immune system, contributing to its ability to cause chronic infections .

3.2. Potential as a Diagnostic or Therapeutic Target

Uncharacterized proteins like MPN_068 could serve as novel targets for diagnostic assays or therapeutic interventions. Given the difficulty in culturing Mycoplasma pneumoniae, serological tests targeting specific proteins are valuable for diagnosis . Additionally, understanding the functions of these proteins can help in developing targeted therapies.

4.2. Research Implications

• Protein-Protein Interactions: Further research is needed to understand how MPN_068 interacts with other proteins within Mycoplasma pneumoniae or host cells.

• Immune Response Modulation: Investigating whether MPN_068 plays a role in modulating the host immune response could provide insights into its potential as a therapeutic target.

References Biocompare. (2025). Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068), partial. CBM15. (n.d.). ELISA Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055.2 homolog (MPN_070). CBM15. (n.d.). ELISA Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068). PMC. (2024). Identification of Mycoplasma pneumoniae proteins interacting with... Colorectal Research. (n.d.). ELISA Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068). PubMed. (2005). Identification and characterization of human surfactant protein A... Cusabio. (2025). Recombinant Mycoplasma pneumoniae Uncharacterized protein MG218.1 homolog (MPN_311). SciELO. (n.d.). TS IN ULAR OGY... NCBI Bookshelf. (2023). Mycoplasma Pneumonia. GeneBioSystems. (2022). Recombinant Mycoplasma pneumoniae Uncharacterized protein MG218.1 homolog (MPN_311).