Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055.2 homolog (MPN_070)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
MPN_070; D09_orf127a; MP085; Uncharacterized protein MG055.2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_070
Target Protein Sequence
MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLI VLGVLEILLMVAQLVMSNMAANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKL VTQTDNI
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN070

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant MPN_070 production?

E. coli is the most commonly used heterologous expression system for Mycoplasma pneumoniae proteins due to its rapid growth, well-established genetic tools, and cost-effectiveness. For MPN_070 expression, several considerations should be addressed:

  • Codon optimization: Mycoplasma has a high AT content in its genome, requiring codon optimization for efficient expression in E. coli

  • Fusion tags: N-terminal 6His-tag fusion is often employed for simplified purification, similar to other Mycoplasma recombinant proteins

  • Expression vector selection: Vectors containing T7 promoters with LacI binding sites offer controlled induction with IPTG, reducing potential toxicity to host cells

For improved expression, a system featuring the T7 polymerase under the control of an inducible promoter (such as the Tet promoter) with appropriate repressors can significantly enhance protein yields. The repressor module comprising Tet repressor and LacI repressor under control of constitutive promoters provides tight regulation of expression .

What are the optimal conditions for purification of recombinant MPN_070?

Purification of MPN_070 requires a systematic approach:

  • Cell lysis: Sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, and 10 mM imidazole with protease inhibitors

  • Initial purification: Ni-NTA affinity chromatography, with step-wise imidazole elution (50, 100, 250 mM)

  • Secondary purification: Size exclusion chromatography using Superdex 200 column in 20 mM Tris-HCl (pH 7.5), 150 mM NaCl

The predicted molecular weight of MPN_070 is approximately 62-65 kDa based on similar uncharacterized Mycoplasma proteins . Purity assessment should be performed using SDS-PAGE with a target purity of >90%.

What analytical methods should be used to confirm the identity of purified MPN_070?

Multiple complementary methods should be employed:

  • Western blotting: Using either anti-His antibodies to detect the fusion tag or specific antibodies against MPN_070 if available

  • Mass spectrometry: Both intact protein MS and peptide mapping following tryptic digestion

  • N-terminal sequencing: To confirm the correct start of the protein and integrity of the fusion tag

  • Dynamic light scattering: To assess homogeneity and determine oligomerization state

When analyzing expression, PCR and DNA sequencing should first be performed to verify the genetic construct, followed by protein detection methods such as Western blotting, as demonstrated for other Mycoplasma recombinant proteins .

What experimental design approaches are most effective for optimizing MPN_070 expression?

Multivariant analysis offers superior optimization compared to traditional univariant methods. For MPN_070 expression, a statistical experimental design approach should:

  • Simultaneously evaluate multiple variables: Media composition, induction temperature, inducer concentration, and harvest time

  • Characterize experimental error: Through technical and biological replicates

  • Establish interaction effects: Between variables that may have synergistic or antagonistic effects

This multivariant method allows researchers to gather high-quality information with fewer experiments compared to changing one variable at a time. For intracellular expression of MPN_070, maximizing cell growth is critical as higher cell density correlates strongly with recombinant protein yield .

Table 1: Example Factorial Design for MPN_070 Expression Optimization

ExperimentTemperature (°C)IPTG (mM)Post-induction time (h)OD600Protein yield (mg/L)
1160.1164.218.5
2161.0163.814.2
3250.1165.122.6
4251.0164.516.8
5160.142.88.3
6161.042.56.7
7250.143.611.2
8251.043.29.5

How can structural and functional characteristics of MPN_070 be determined given its uncharacterized nature?

A comprehensive approach to characterizing MPN_070 should include:

  • Bioinformatic analysis:

    • Sequence homology comparison with characterized proteins

    • Structural prediction using AlphaFold2 or similar tools

    • Identification of conserved domains and motifs

  • Structural studies:

    • Circular dichroism to determine secondary structure composition

    • X-ray crystallography or cryo-EM for tertiary structure

    • NMR for dynamic regions and ligand interactions

  • Functional assays:

    • Binding partner identification through pull-down assays and mass spectrometry

    • Enzymatic activity screening based on structural predictions

    • Gene knockout studies in Mycoplasma pneumoniae to observe phenotypic effects

Given that MPN_070 is uncharacterized, these studies should be guided by bioinformatic predictions and homology to MG281 and other related proteins in the Mycoplasma genus .

What are the challenges in achieving soluble expression of MPN_070 and strategies to overcome them?

Common challenges in expressing Mycoplasma proteins in E. coli include:

  • Poor solubility: Mycoplasma proteins often form inclusion bodies in E. coli due to differences in folding environments and chaperone systems.

  • Codon bias: Mycoplasma pneumoniae has a distinctive codon usage pattern that can hinder efficient translation in E. coli.

  • Toxicity to host cells: Some Mycoplasma proteins interfere with host cell processes.

Strategies to overcome these challenges include:

  • Fusion partners: Use solubility-enhancing tags like SUMO, MBP, or GST

  • Expression conditions: Lower temperatures (16-20°C) and reduced inducer concentrations

  • Co-expression with chaperones: GroEL/GroES, DnaK/DnaJ/GrpE systems

  • Cell-free expression systems: Bypass toxicity issues

  • Design of a specialized expression platform: Include regulated expression elements and repressors as designed in the "Cloning Platform" described for Mycoplasma proteins

Table 2: Fusion Tag Comparison for MPN_070 Expression

Fusion TagSize (kDa)Effect on SolubilityPurification MethodCleavage Required
6His1MinimalIMACNo
MBP42HighAmylose resinYes
GST26ModerateGlutathione resinYes
SUMO11HighIMACYes
Thioredoxin12ModerateIMACYes

How can MPN_070 be used to advance our understanding of Mycoplasma pneumoniae pathogenesis?

MPN_070, as an uncharacterized protein, represents an opportunity to discover novel aspects of Mycoplasma pneumoniae biology and pathogenesis:

  • Potential virulence factor: Many uncharacterized Mycoplasma proteins have been found to contribute to pathogenesis through host interaction or immune modulation.

  • Biomarker development: Characterization of MPN_070 could identify potential diagnostic biomarkers for Mycoplasma pneumoniae infection, which is especially important given the challenges in current diagnostic methodologies .

  • Therapeutic target identification: Novel proteins provide potential targets for antimicrobial development, particularly important given the increasing macrolide resistance in Mycoplasma pneumoniae .

Research approaches should include:

  • Generation of antibodies against MPN_070 to study its expression during infection

  • Protein-protein interaction studies to identify host targets

  • Animal model studies to assess its role in virulence

  • Comparative expression analysis between macrolide-resistant and macrolide-sensitive strains

How can recombinant MPN_070 be used for molecular typing of Mycoplasma pneumoniae strains?

Recombinant MPN_070 can serve as a tool for developing molecular typing strategies:

  • Antibody development: Purified recombinant MPN_070 can be used to generate specific antibodies for typing through immunological methods.

  • Sequence variation analysis: Comparison of MPN_070 sequences across clinical isolates may reveal strain-specific variations.

  • Integration with existing typing methods: MPN_070 analysis can complement current typing approaches such as:

    • P1 gene typing through PCR-RFLP, which categorizes MP strains into types I and II

    • Multiple-locus variable-number tandem-repeat analysis (MLVA), which offers higher discriminatory power than P1 gene typing

Emerging research indicates that certain MLVA types (particularly 4-5-7-2 and 3-5-6-2) are strongly associated with macrolide resistance . Adding MPN_070 variation analysis to this typing approach could potentially enhance strain discrimination and provide additional correlations with clinical outcomes.

What analytical approaches can determine if MPN_070 contributes to macrolide resistance in Mycoplasma pneumoniae?

To investigate potential relationships between MPN_070 and macrolide resistance:

  • Comparative genomics:

    • Sequence comparison between macrolide-resistant and macrolide-sensitive strains

    • Analysis of MPN_070 expression levels across resistant and sensitive strains

  • Functional studies:

    • Overexpression of MPN_070 in sensitive strains to assess changes in resistance profiles

    • Knockout or knockdown studies in resistant strains

  • Structural biology approaches:

    • Investigation of potential interactions between MPN_070 and macrolide antibiotics

    • Analysis of co-localization with established resistance determinants

This research would be particularly valuable given the increasing prevalence of macrolide-resistant Mycoplasma pneumoniae strains, which are associated with more severe clinical manifestations and longer hospital stays .

What data analysis methodologies are appropriate for MPN_070 functional studies?

  • Identification phase: Clearly define the biological question regarding MPN_070 function or characterization .

  • Data collection: Gather data from expression studies, functional assays, and comparative analyses .

  • Data cleaning: Process raw data to eliminate duplicates, anomalies, and inconsistencies before analysis .

  • Analysis approaches:

    • Statistical comparison between experimental groups

    • Correlation analysis between MPN_070 expression and phenotypic variables

    • Structural homology modeling validation

  • Interpretation:

    • Contextualize findings within the broader understanding of Mycoplasma pneumoniae biology

    • Identify limitations and potential confounding factors

For analyzing protein-protein interactions or differential expression studies involving MPN_070, appropriate statistical methods should include correction for multiple comparisons and validation through orthogonal techniques.

How should researchers design controlled experiments to validate MPN_070 function in Mycoplasma pneumoniae?

Experimental design for validating MPN_070 function should include:

  • Genetic manipulation strategies:

    • Construction of MPN_070 knockout mutants

    • Complementation studies to confirm phenotype specificity

    • Conditional expression systems to study essential functions

  • Controls:

    • Wild-type Mycoplasma pneumoniae strains

    • Strains with mutations in unrelated genes

    • Empty vector controls for complementation studies

  • Phenotypic analysis:

    • Growth curves under various conditions

    • Adherence to host cells

    • Cytotoxicity assessment

    • Antibiotic susceptibility profiles

  • Experimental conditions:

    • Multiple biological replicates (minimum n=3)

    • Technical replicates to assess measurement variability

    • Time-course studies to capture dynamic processes

Researchers should employ the multivariant analysis approach to efficiently identify significant variables and their interactions, optimizing experimental conditions while minimizing the number of required experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.