Recombinant Mycoplasma pneumoniae Uncharacterized protein MG076 homolog (MPN_214)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To ensure a specific tag type, please inform us beforehand; we will prioritize its development.
Synonyms
MPN_214; G07_orf138; MP617; Uncharacterized protein MG076 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_214
Target Protein Sequence
MLGTQTTNSKPREYGGLIVSTIYIVLFFAILNLTVFFNKTNNINLILKNSCVVSFVVVWL LVCLQGIVRLKTCDGARYEISKFNQYLKLGSIYAKPNISFDEYKAKSSSYRKQTRGFWWM NFSLYLLGSLISIVVSLL
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN214

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the known synonyms and identifiers for MPN_214 protein?

MPN_214 protein is referenced through several different identifiers in scientific literature and databases:

Identifier TypeValue
Gene NameMPN_214
SynonymsMG076 homolog; G07_orf138; MP617; Uncharacterized protein MG076 homolog
UniProt IDP75555
Common Product CodeRFL30111MF (for recombinant version)

This diversity of identifiers reflects the protein's appearance across different annotation systems and genomic analyses of Mycoplasma pneumoniae . Researchers should be aware of these alternative identifiers when conducting literature searches to ensure comprehensive coverage.

How does MPN_214 relate to the evolutionary characteristics of Mycoplasma pneumoniae?

MPN_214 represents an interesting case study in Mycoplasma evolution. Mycoplasmas are distinctive bacteria that evolved through dramatic genome reduction, resulting in some of the smallest genomes among free-living organisms . Despite this reduction, Mycoplasma pneumoniae maintains repetitive elements in its genome, suggesting selective pressure to retain certain genetic features.

As an uncharacterized protein, MPN_214 may represent a conserved function specific to Mycoplasma biology. The retention of this gene through evolutionary genome minimization suggests it likely serves an important function, possibly related to the unique parasitic lifestyle of these cell wall-less bacteria . Understanding MPN_214 may provide insights into core functions that were retained during the reductive evolution of Mycoplasma species.

What are the optimal storage and handling conditions for recombinant MPN_214 protein?

The recombinant MPN_214 protein requires specific handling procedures to maintain stability and functionality:

Storage Recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires 5-50% glycerol (50% is recommended) as a cryoprotectant

Buffer Conditions:

  • The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • This buffer formulation helps maintain protein stability while in lyophilized form

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. These storage recommendations are based on established protocols for maintaining the structural integrity of recombinant proteins expressed in E. coli systems.

What is the recommended reconstitution protocol for lyophilized MPN_214 protein?

For optimal reconstitution of lyophilized MPN_214 protein:

  • Centrifuge the vial briefly before opening to bring all contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

This reconstitution method optimizes protein solubility while minimizing potential degradation. The addition of glycerol serves as a cryoprotectant to prevent damage during freezing. Researchers should perform a test reconstitution with a small amount of protein to verify solubility before processing the entire sample.

How can researchers verify the purity and integrity of recombinant MPN_214 protein?

The verification of MPN_214 protein purity and integrity should follow standard protein characterization methods:

SDS-PAGE Analysis:

  • The recombinant protein typically shows greater than 90% purity as determined by SDS-PAGE

  • The expected molecular weight can be calculated from the amino acid sequence (approximately 15-16 kDa for the core protein plus additional weight for the His-tag)

Western Blot:

  • Anti-His antibodies can detect the His-tagged protein

  • This approach confirms both the presence and expected size of the tagged protein

Mass Spectrometry:

  • For confirmation of protein identity, tryptic digest followed by mass spectrometry can verify the amino acid sequence

  • This approach is particularly valuable for uncharacterized proteins to confirm their identity

Researchers should include positive controls (other His-tagged proteins) and negative controls (non-tagged proteins) when performing these verification steps to ensure specificity of detection methods.

How can intron analysis methodologies be applied to study MPN_214 and related genes?

Intron analysis methodologies represent a sophisticated approach to studying genetic variation in Mycoplasma species, applicable to MPN_214 research:

PCR Amplification Strategy:
Previous studies on Mycoplasma species have revealed that PCR amplification of nuclear small subunit ribosomal DNA (nrSSU rDNA) can yield fragments with unexpected sizes due to the presence of group I introns . For MPN_214, researchers could:

  • Design primers flanking the complete MPN_214 coding region

  • Compare amplicon sizes across different Mycoplasma strains to detect potential introns

  • Sequence variants to identify insertion positions within the gene

Intron Presence/Absence Analysis:
Studies have demonstrated that the presence or absence of introns serves as a valuable marker for examining population structure in related organisms . This approach could be applied to MPN_214 to:

  • Determine if MPN_214 contains introns across different Mycoplasma pneumoniae strains

  • Use the patterns of intron presence/absence to infer evolutionary relationships

  • Correlate intron patterns with functional variations in the protein

This methodology has previously identified distinct size classes (Class I, II, and III) in related genes, with variations in the number and position of introns . Similar patterns might exist in MPN_214, providing insights into the gene's evolution and population genetics.

What experimental design considerations are crucial when studying MPN_214 protein function?

When designing experiments to investigate the function of uncharacterized proteins like MPN_214, several critical considerations must be addressed:

Sex as a Biological Variable:

  • Statistical power analysis should be performed to determine appropriate sample sizes when designing animal experiments

  • Analysis of variance (ANOVA) approaches can help determine if sex influences protein function or expression

  • Reporting should include effect sizes (partial eta²) and power calculations as shown in the following reference table:

Analysis TypeEffect Size (f)Power (1-β)Sample Size for Power ≥0.8
Main effect of sex0.3830.22556 (28M, 28F)
Dose x sex interaction0.5530.65716 (8M, 8F)

This approach ensures sufficient statistical power to detect sex-specific effects in functional studies .

Cell Line Selection:

  • Given that MPN_214 is expressed in E. coli for recombinant production , researchers should consider:

    • Using multiple expression systems to verify function (bacterial, yeast, mammalian)

    • Testing function in cell lines relevant to Mycoplasma pneumoniae infection (respiratory epithelial cells)

    • Designing controls that account for tag-related artifacts (comparing His-tagged vs. untagged versions)

Functional Prediction Approaches:

  • Leverage comparative genomics with other Mycoplasma species

  • Apply structural prediction tools to identify potential functional domains

  • Consider evolutionary conservation patterns to infer functional constraints

These design considerations ensure robust experimental frameworks capable of generating reliable insights into the function of this uncharacterized protein.

How can RFLP analysis be applied to study MPN_214 gene variation across populations?

Restriction Fragment Length Polymorphism (RFLP) analysis offers a powerful approach to studying genetic variation in MPN_214 across different populations:

RFLP Methodology for MPN_214:

  • Amplify the MPN_214 gene and associated regions using PCR

  • Select appropriate restriction enzymes based on predicted cut sites within the sequence

  • Analyze fragment patterns to identify genotype variations

  • Apply statistical methods like Analysis of Molecular Variance (AMOVA) to quantify population subdivision

Previous studies on related organisms have revealed significant insights through this approach. For example, RFLP analysis of ITS regions in Cladonia arbuscula identified distinct genotypes that helped infer dispersal mechanisms . Similar approaches with MPN_214 could:

  • Identify population-specific variants of MPN_214

  • Help understand the evolutionary pressures on this gene

  • Reveal potential structural variations that might influence protein function

This methodology is particularly valuable for uncharacterized proteins like MPN_214, as it can identify natural variants that might indicate functional constraints or adaptations across different environments or host populations.

What statistical approaches are recommended for analyzing MPN_214 experimental data?

When analyzing experimental data related to MPN_214, researchers should employ rigorous statistical methods appropriate for the experimental design:

For Gene Expression Studies:

  • Two-way ANOVA is recommended when examining effects of multiple factors (e.g., sex, treatment) on MPN_214 expression

  • Report F-statistics, degrees of freedom, p-values, effect sizes, and power analyses

  • For example: F (1,10) = 4.34, p = 0.0639, partial eta² = 0.383, power = 0.225

For Population Genetics:

  • Analysis of Molecular Variance (AMOVA) can determine population subdivision

  • Report the percentage of variation explained by different hierarchical levels

  • Interpret population structure in the context of geographical or environmental factors

For Protein Function Analysis:

  • When comparing wildtype vs. mutant forms, appropriate parametric or non-parametric tests should be selected based on data normality

  • Multiple testing corrections (e.g., Bonferroni, FDR) should be applied when conducting numerous comparisons

  • Power analysis should be performed to ensure adequate sample size

These statistical approaches ensure robust interpretation of experimental results and facilitate meaningful comparisons with other studies in the literature.

How should researchers approach functional prediction for uncharacterized proteins like MPN_214?

Predicting the function of uncharacterized proteins like MPN_214 requires an integrated bioinformatic approach:

Sequence-Based Prediction:

  • Conduct Basic Local Alignment Search Tool (BLAST) searches against well-characterized protein databases

  • Identify conserved domains using InterPro, Pfam, or PROSITE

  • Perform multiple sequence alignments with homologs to identify conserved residues

Structural Prediction:

  • Use tools like AlphaFold or I-TASSER to predict 3D structure

  • Identify structural motifs that might suggest function

  • Analyze potential binding pockets or active sites

Genomic Context Analysis:

  • Examine neighboring genes in the Mycoplasma pneumoniae genome

  • Identify potential operons or functionally related gene clusters

  • Compare synteny across different Mycoplasma species

Evolutionary Analysis:

  • Construct phylogenetic trees to understand evolutionary relationships

  • Analyze selective pressure (dN/dS ratios) to identify functionally important regions

  • Consider the significance of MPN_214's retention despite Mycoplasma's genome reduction

By integrating these approaches, researchers can develop testable hypotheses about MPN_214's function that can guide subsequent experimental validation.

What considerations are important when interpreting protein-protein interaction data for MPN_214?

Interpreting protein-protein interaction (PPI) data for uncharacterized proteins like MPN_214 requires careful consideration of several factors:

Experimental System Limitations:

  • His-tagged versions of MPN_214 might exhibit altered interaction profiles compared to native protein

  • E. coli expression systems may lack post-translational modifications present in Mycoplasma

  • Buffer conditions during experiments can significantly influence interaction detection

Statistical Validation:

  • Apply appropriate statistical tests to distinguish true interactions from background

  • Consider using scoring systems that integrate multiple lines of evidence

  • Report false discovery rates and confidence intervals

Biological Context:

  • Interpret interactions in light of Mycoplasma pneumoniae's minimal genome

  • Consider the cell wall-less nature of Mycoplasmas when evaluating membrane-related interactions

  • Assess whether interactions are conserved across different Mycoplasma species

Validation Approaches:

  • Confirm key interactions using multiple methodologies (pull-down, co-immunoprecipitation, FRET)

  • Perform domain mapping to identify specific interaction regions

  • Validate biological relevance through functional assays

These considerations help ensure that PPI data for MPN_214 is interpreted accurately, leading to reliable insights into the protein's function within the Mycoplasma pneumoniae cellular network.

What are common challenges in PCR amplification of Mycoplasma genes and how can they be addressed?

PCR amplification of Mycoplasma genes, including MPN_214, presents several challenges that researchers should anticipate:

Challenge: Unexpected Fragment Sizes
Previous studies with Mycoplasma genes have revealed PCR products significantly larger than expected due to the presence of introns. For example, amplification of nrSSU rDNA revealed fragments that were 200, 400, and 600 nucleotides longer than anticipated .

Solution:

  • Design primers that account for potential intron locations

  • Use long-range PCR enzymes capable of amplifying larger fragments

  • Verify product identity through sequencing rather than relying solely on band size

Challenge: Group I Introns
The presence of putative group I introns at specific positions (e.g., position 1624 and 1777 in nrSSU rDNA) can complicate amplification and analysis .

Solution:

  • Design primers that flank potential intron sites

  • Consider using nested PCR approaches to improve specificity

  • Analyze sequence data carefully to identify intron-exon boundaries

Challenge: Population-Level Variation
Studies have shown that even closely located populations can show distinct genetic profiles, complicating interpretation .

Solution:

  • Include multiple isolates from each study site

  • Characterize population structure before making functional inferences

  • Use appropriate statistical approaches like AMOVA to quantify variation

These approaches can help researchers overcome common challenges in Mycoplasma gene amplification and ensure reliable results when working with MPN_214.

How can researchers optimize expression and purification of recombinant MPN_214 protein?

Optimizing the expression and purification of recombinant MPN_214 involves several key considerations:

Expression System Optimization:

  • The current protocol uses E. coli expression with an N-terminal His tag

  • Consider testing different expression systems:

    • Different E. coli strains (BL21, Rosetta for rare codons)

    • Alternative tags (GST, MBP) that may improve solubility

    • Inducible promoters with variable induction conditions

Purification Optimization:

  • For His-tagged MPN_214, nickel affinity chromatography is the primary purification method

  • Consider these optimization steps:

    • Test different imidazole concentrations in wash and elution buffers

    • Add low concentrations of detergents if hydrophobic regions cause aggregation

    • Include reducing agents if cysteine residues might form disulfide bonds

Storage Buffer Optimization:
Current recommendations include:

  • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • 5-50% glycerol for long-term storage

  • Additional optimizations might include:

    • Testing different pH values (7.0-8.5)

    • Adding stabilizing agents like low concentrations of reducing agents

    • Determining optimal protein concentration to prevent aggregation

Quality Control Measures:

  • SDS-PAGE analysis to verify purity (>90%)

  • Dynamic light scattering to assess aggregation state

  • Circular dichroism to verify proper folding

These optimization strategies can help researchers maximize yield and maintain the structural integrity of recombinant MPN_214 protein for functional studies.

What approaches can address protein stability issues with recombinant MPN_214?

Addressing stability issues with recombinant MPN_214 requires systematic troubleshooting based on the protein's characteristics:

Preventing Freeze-Thaw Damage:

  • Current recommendations advise against repeated freeze-thaw cycles

  • Implementation strategies include:

    • Preparing single-use aliquots immediately after purification

    • Storing working aliquots at 4°C for up to one week

    • Using controlled freezing rates to minimize ice crystal formation

Addressing Aggregation:

  • The highly hydrophobic regions in MPN_214's sequence suggest potential aggregation issues

  • Mitigation approaches include:

    • Adding mild, non-ionic detergents (0.01-0.1% Triton X-100 or NP-40)

    • Optimizing protein concentration (typically keeping below 1 mg/mL)

    • Including solubilizing agents like arginine or trehalose

Oxidative Damage Prevention:

  • The presence of cysteine residues (position 71 in the sequence) suggests potential sensitivity to oxidation

  • Preventive measures include:

    • Adding reducing agents (DTT, β-mercaptoethanol, or TCEP)

    • Ensuring buffers are degassed and containers are filled to minimize air contact

    • Including antioxidants like EDTA to chelate metal ions that catalyze oxidation

Stability Monitoring:

  • Implement regular quality control:

    • Size-exclusion chromatography to detect aggregation

    • Activity assays to verify functional integrity over time

    • Mass spectrometry to identify potential degradation products

By implementing these approaches, researchers can significantly improve the stability and reproducibility of experiments utilizing recombinant MPN_214 protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.