Recombinant Mycoplasma pneumoniae Uncharacterized protein MG133 homolog (MPN_274)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Context

MPN_274 (UniProt ID: P75503) is annotated as an uncharacterized protein in M. pneumoniae strain M129. It is part of the DUF16 protein family, which is conserved across mycoplasma species and associated with essential genomic functions . Key identifiers include:

  • Gene name: MPN_274

  • Synonyms: A65_orf266, MP561

  • Homolog: MG133 in Mycoplasma genitalium

Primary Sequence and Domains

  • Length: 266 amino acids

  • Molecular weight: ~34–37 kDa (theoretical)

  • Predicted features: A signal peptide (amino acids 1–26) suggests membrane association , though experimental validation for MPN_274 is pending.

Functional Insights

While MPN_274 lacks direct functional characterization, inferences can be drawn from homologs and genomic context:

  • DUF16 family: Members are essential for mycoplasma survival and may interact with host immune receptors like NOD2 .

  • Recombinant production: Expressed in E. coli with an N-terminal His tag, enabling purification via affinity chromatography .

Research Applications

Recombinant MPN_274 is commercially available for exploratory studies:

ApplicationDetails
Antigen productionUsed to generate antibodies for mycoplasma detection .
Structural studiesPurity >90% (SDS-PAGE) supports crystallography or NMR .
Host-pathogen interactionsPotential role in immune evasion or adhesion inferred from DUF16 family traits .

Table 1: Biochemical Properties of Recombinant MPN_274

PropertyValue
Expression systemEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 50% glycerol for stability

Table 2: Genomic and Proteomic Context

FeatureDescription
Genomic locationM. pneumoniae chromosome, RepMP-associated regions
Conserved motifsDUF16 domain (amino acids 13–90) implicated in protein trafficking
HomologsMG_186 (M. genitalium), MPN133 (M. pneumoniae nuclease)

Future Directions

  • Functional studies: Clarify MPN_274’s role in M. pneumoniae pathogenesis, particularly in immune evasion or adhesion.

  • Structural analysis: Resolve 3D structure to identify binding pockets or interaction sites.

  • Clinical relevance: Explore diagnostic or therapeutic potential given its surface localization and immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_274; A65_orf266; MP561; Uncharacterized protein MG133 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_274
Target Protein Sequence
MKKTIGLAYRFFYLNNNCDFYLLFLAPFSLFNLGVMVASAVISVVYNNQPQLIWFTNFDT FTYQSNTIAAVCVLMYLCKRRCKLFDNNALFLSAAGYLVFTVIFFNLYVLSRVTGFVNVE EHVKGWFSTITSEMPYSFSGNPLTDWISFAQLFLHVIYPASFFGFIWIFFKTYKMREPLH ELGKFLLKAGVYPSLYAFYLQTVPFLKIWDNGHDSYSVYGFFSQTKYNSYVWFWSIPIFA SMFLILWGLFVINNRYYGAKTKYGKQ
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN274

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma pneumoniae and why is it significant for studying minimal proteomes?

Mycoplasma pneumoniae is a human respiratory pathogen belonging to the Mollicutes, a group of bacteria with the smallest genomes capable of independent life. These organisms have undergone reductive evolution, resulting in limited regulatory features for gene expression . M. pneumoniae causes respiratory infections that significantly impact both elderly populations and children, with particular concerns about its pathogenicity mechanisms .

The significance of M. pneumoniae in minimal proteome research stems from its streamlined genome, making it an excellent model for understanding essential protein functions. With fewer regulatory proteins compared to more complex bacteria, M. pneumoniae relies heavily on posttranslational regulation, particularly protein phosphorylation, to adapt to environmental changes . This simplified system allows researchers to investigate fundamental questions about protein function with fewer confounding variables than in more complex organisms.

How do researchers approach the characterization of uncharacterized proteins like MPN_274?

Characterizing uncharacterized proteins requires a multi-faceted approach combining bioinformatic, biochemical, and genetic methods. For proteins like MPN_274, researchers typically begin with sequence homology analysis to identify potential functional domains or similarities to characterized proteins in other organisms.

The experimental approach often follows these methodological steps:

  • Bioinformatic analysis: Sequence alignment, structural prediction, and identification of conserved domains

  • Recombinant protein expression and purification for in vitro studies

  • Protein-protein interaction studies using bacterial two-hybrid approaches

  • Phosphoproteome analysis to identify potential phosphorylation sites

  • Genetic manipulation through generation of knockout or overexpression mutants

  • Phenotypic characterization of mutants compared to wild-type strains

For MPN_274 specifically, researchers would likely compare it to its homolog MG133 and look for conserved features that might indicate functional significance. Complete phosphoproteome analysis using two-dimensional gel electrophoresis and mass spectrometry, as performed for other M. pneumoniae proteins, can reveal whether MPN_274 undergoes phosphorylation and potential regulation .

What experimental evidence suggests potential functions for uncharacterized proteins in minimal organisms?

Experimental evidence for potential functions of uncharacterized proteins in minimal organisms like M. pneumoniae often comes from integrated approaches that combine:

  • Phosphoproteome mapping: Studies have detected 63 phosphorylated proteins in M. pneumoniae, including many enzymes involved in central carbon metabolism and proteins related to host cell adhesion . Detection of phosphorylation sites on uncharacterized proteins suggests regulatory roles.

  • Protein-protein interaction networks: The bacterial two-hybrid approach has revealed that glycolytic enzymes in M. pneumoniae form a structured interaction network, with enolase acting as a central hub that interacts with all other glycolytic enzymes . Similar approaches could reveal interaction partners for MPN_274.

  • Mutant phenotyping: Phenotypic characterization of mutants has revealed that certain proteins, such as the serine/threonine protein kinase PrkC, affect critical functions like cell adhesion and virulence in M. pneumoniae . Similar approaches could determine if MPN_274 affects key cellular processes.

  • Complementation studies: Testing whether MPN_274 can functionally replace its homolog MG133 in other species can provide evidence of conserved functionality.

How should researchers design experiments to characterize phosphorylation patterns of uncharacterized proteins?

Designing experiments to characterize phosphorylation patterns requires careful consideration of the following methodological steps:

  • Define variables clearly:

    • Independent variables: Growth conditions, presence/absence of specific kinases/phosphatases

    • Dependent variables: Phosphorylation status, protein activity, cellular phenotype

    • Control variables: Growth media composition, temperature, pH

  • Develop specific testable hypotheses:
    For example: "MPN_274 undergoes phosphorylation by PrkC kinase at conserved serine/threonine residues under glucose-limiting conditions."

  • Design experimental treatments:

    • Wild-type vs. kinase/phosphatase mutant strains (e.g., prpC, prkC, hprK mutants)

    • Various growth conditions (nutrient limitation, stress conditions)

    • Genetic complementation with site-directed mutants

  • Plan measurement approaches:

    • Two-dimensional gel electrophoresis followed by mass spectrometry

    • Phospho-specific antibodies if available

    • Radioactive labeling with 32P

    • Phosphoprotein staining methods

  • Data analysis plan:

    • Statistical comparison of phosphorylation patterns across conditions

    • Correlation of phosphorylation with phenotypic changes

    • Integration with other proteomics data

The experimental design should incorporate appropriate controls, including both positive controls (known phosphorylated proteins like HPr) and negative controls (phosphorylation-site mutants) .

What variables should be considered when studying protein-protein interactions involving uncharacterized proteins?

When designing experiments to study protein-protein interactions involving uncharacterized proteins like MPN_274, researchers should consider these experimental variables:

Variable CategorySpecific VariablesMethodological Considerations
Protein ExpressionExpression level, fusion tags, expression systemMay affect folding and interaction capacity
Environmental ConditionspH, temperature, ionic strength, molecular crowdingCan promote or inhibit specific interactions
Cellular ContextIn vitro vs. in vivo, subcellular localizationCellular environment may provide cofactors
Temporal FactorsGrowth phase, cell cycle stageSome interactions may be transient or condition-specific
Detection MethodsSensitivity, specificity, false positive/negative ratesDifferent methods have different biases

For studying interactions involving MPN_274, researchers should consider the bacterial two-hybrid system, which has been successfully used to map interactions among glycolytic enzymes in M. pneumoniae . This approach revealed that most glycolytic enzymes perform self-interactions and that glycolysis proceeds in a well-structured manner even in minimal organisms.

When interpreting results, it's crucial to validate interactions using multiple complementary methods and to consider the possibility of indirect interactions mediated by intermediary proteins.

How can researchers analyze contradictory findings regarding protein function in minimal organisms?

Analyzing contradictory findings about protein function in minimal organisms like M. pneumoniae requires a methodological framework that includes:

  • Systematic comparison of experimental conditions:

    • Create a detailed comparison table of methods, strains, and conditions used

    • Identify critical differences that might explain discrepancies (media composition, growth phase, assay sensitivity)

  • Reproducibility assessment:

    • Attempt to reproduce conflicting results using standardized protocols

    • Collaborate with labs reporting contradictory findings

  • Integrated multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Look for context-dependent patterns that might explain functional variations

    • Consider phosphorylation status as a potential regulatory mechanism

  • Genetic approach to resolve conflicts:

    • Generate clean knockout mutants with complementation controls

    • Create point mutations in key residues (e.g., predicted phosphorylation sites)

    • Perform epistasis analysis with related genes

  • Evolutionary context analysis:

    • Compare homologous proteins across related species

    • Analyze conservation patterns of key residues

    • Consider evolutionary pressure and functional redundancy

An example from M. pneumoniae research shows how this approach can resolve contradictions: When studying glycerophosphodiesterases, researchers found that while both MPN420 (GlpQ) and MPN566 were predicted to have similar functions, only GlpQ showed enzymatic activity in vitro. Further analysis revealed that GlpQ was crucial for hydrogen peroxide formation and cytotoxicity, while MPN566 inactivation produced no detectable phenotype .

How might phosphorylation patterns of MPN_274 relate to Mycoplasma pneumoniae pathogenicity?

The relationship between MPN_274 phosphorylation and M. pneumoniae pathogenicity would need to be investigated through several methodological approaches:

Protein phosphorylation has been shown to play a critical role in M. pneumoniae pathogenicity. The serine/threonine protein kinase PrkC phosphorylates key cytadherence proteins, including the major adhesin P1 and cytadherence proteins HMW1 and HMW3. Inactivation of PrkC results in a nonadherent growth phenotype and loss of cytotoxicity toward HeLa cells, demonstrating that posttranslational modification of cytadherence proteins is essential for cell adhesion and virulence .

If MPN_274 undergoes phosphorylation, researchers should investigate:

  • Whether MPN_274 is phosphorylated by known kinases (PrkC, HPrK)

  • If phosphorylation status changes during infection or under stress conditions

  • Whether phosphorylation affects protein localization, stability, or interaction partners

  • If MPN_274 has any direct or indirect interactions with known virulence factors

Research could utilize mutant strains (ΔprkC, ΔprpC) to assess the impact on MPN_274 phosphorylation, coupled with cytotoxicity assays using HeLa cells to measure pathogenicity . Comparative phosphoproteomics between wild-type and mutant strains would reveal whether MPN_274 is among the proteins affected by these regulatory enzymes.

What techniques are most effective for determining the structure-function relationship of uncharacterized proteins?

Determining structure-function relationships for uncharacterized proteins like MPN_274 requires an integrated approach combining:

  • Computational structure prediction:

    • Homology modeling based on related proteins with known structures

    • Ab initio modeling for unique domains

    • Molecular dynamics simulations to predict conformational changes

  • Experimental structure determination:

    • X-ray crystallography of recombinant protein

    • NMR spectroscopy for flexible regions

    • Cryo-electron microscopy for larger protein complexes

  • Structure-guided functional analysis:

    • Site-directed mutagenesis of predicted functional residues

    • Domain deletion or swapping experiments

    • Identification of conserved structural motifs

  • Integration with interaction data:

    • Docking studies with predicted interaction partners

    • Co-crystallization with binding partners

    • Chemical cross-linking coupled with mass spectrometry

For phosphoproteins, it's particularly important to determine how phosphorylation affects structure. Interestingly, comparison of phosphoproteomes across bacteria has revealed weak conservation of phosphorylation sites, even when the same proteins are phosphorylated in related organisms . This suggests that protein phosphorylation evolved to be highly specific for each individual organism, making it crucial to study modifications directly in M. pneumoniae rather than relying solely on homology-based predictions.

How can vaccine development benefit from research on uncharacterized Mycoplasma pneumoniae proteins?

Vaccine development against M. pneumoniae faces significant challenges due to poor immunogenicity and side effects of inactivated or attenuated vaccines . Research on uncharacterized proteins offers several methodological approaches to overcome these challenges:

  • Identification of novel antigens:

    • Uncharacterized proteins like MPN_274 may represent previously unexplored antigens

    • Recombinant expression allows testing of immune responses in isolation

    • Surface-exposed or secreted uncharacterized proteins are particularly valuable candidates

  • Recombinant vector-based approaches:

    • Insertion of M. pneumoniae antigen genes into viral vectors, such as influenza virus

    • Current research has demonstrated success with major antigens P1a and P30a inserted into influenza virus nonstructural protein genes

    • Similar approaches could incorporate MPN_274 if immunogenic properties are identified

  • Multi-epitope vaccine design:

    • Computational prediction of B-cell and T-cell epitopes from uncharacterized proteins

    • Combination of epitopes from multiple proteins to enhance immunogenicity

    • Epitope presentation on nanoparticles or virus-like particles

  • Adjuvant development:

    • Some bacterial proteins have intrinsic adjuvant properties

    • Uncharacterized proteins could potentially serve dual roles as antigens and adjuvants

    • Testing different formulations with recombinant proteins

The process developed for recombinant influenza vaccines expressing M. pneumoniae antigens provides a methodological framework that could be adapted for MPN_274. This includes constructing recombinant vectors, cotransfection with viral fragments, verification by RT-PCR and sequencing, and assessment of genetic stability through successive generations .

What are the best practices for expressing and purifying recombinant Mycoplasma pneumoniae proteins?

Expression and purification of recombinant M. pneumoniae proteins present unique challenges due to the organism's low GC content and use of UGA as a tryptophan codon rather than a stop codon. Best practices include:

  • Expression system selection:

    • E. coli BL21(DE3) with codon optimization or Rosetta strains (providing rare tRNAs)

    • Baculovirus systems for proteins toxic to bacterial hosts

    • Cell-free systems for difficult-to-express proteins

  • Gene optimization considerations:

    • Codon optimization for expression host

    • UGA to TGG conversion for tryptophan codons

    • Optimization of mRNA secondary structures and removal of cryptic splice sites

  • Fusion tag selection strategy:

    • Solubility-enhancing tags (MBP, SUMO, TrxA) for proteins prone to aggregation

    • Affinity tags (His, GST, FLAG) for purification

    • Inclusion of TEV or PreScission protease sites for tag removal

  • Expression condition optimization:

    • Temperature reduction (16-25°C) for improved folding

    • Varying induction conditions (IPTG concentration, induction time)

    • Addition of osmolytes or folding enhancers

  • Purification strategy design:

    • Initial capture using affinity chromatography

    • Secondary purification by ion exchange or size exclusion chromatography

    • Quality control by SDS-PAGE, dynamic light scattering, and mass spectrometry

The success of recombinant expression has been demonstrated with various M. pneumoniae proteins, including adhesins P1 and P30, which have been successfully inserted into viral vectors . Similar approaches should be applicable to MPN_274, though optimization may be required based on protein-specific properties.

How should researchers design phosphoproteomics experiments to identify regulatory networks in minimal organisms?

Designing effective phosphoproteomics experiments for minimal organisms like M. pneumoniae requires careful planning:

  • Sample preparation optimization:

    • Rapid cell lysis to preserve physiological phosphorylation state

    • Use of phosphatase inhibitors to prevent dephosphorylation

    • Subcellular fractionation to enrich for specific cellular compartments

  • Phosphopeptide enrichment strategies:

    • Immobilized metal affinity chromatography (IMAC)

    • Titanium dioxide (TiO2) chromatography

    • Phospho-specific antibodies for targeted analysis

    • Sequential elution from IMAC (SIMAC) for enhanced coverage

  • Mass spectrometry method development:

    • Data-dependent acquisition for discovery experiments

    • Targeted approaches (PRM/MRM) for quantification of specific sites

    • Electron transfer dissociation (ETD) for intact protein analysis

  • Experimental design for biological insights:

    • Comparison of wild-type vs. kinase/phosphatase mutants

    • Time-course experiments to capture dynamic regulation

    • Varying growth conditions to identify condition-specific regulation

  • Data analysis pipeline:

    • Site localization algorithms to precisely identify modified residues

    • Motif analysis to identify kinase recognition sequences

    • Integration with interaction networks and phenotypic data

This approach has already yielded significant insights into M. pneumoniae phosphorylation networks. Comparison of phosphoproteomes between wild-type and mutant strains (ΔhprK, ΔprkC, ΔprpC) revealed that HPrK specifically phosphorylates HPr, while PrkC targets six proteins including the major adhesin P1 and cytadherence proteins HMW1 and HMW3 . Similar analyses could determine whether MPN_274 is part of these regulatory networks.

What bioinformatic approaches are most valuable for predicting functions of uncharacterized bacterial proteins?

Predicting functions of uncharacterized bacterial proteins requires an integrated bioinformatic approach:

ApproachTools/DatabasesApplication to MPN_274
Sequence HomologyBLAST, HHpred, HMMERIdentify relationship to MG133 and other homologs
Domain PredictionInterPro, Pfam, SMARTIdentify functional domains and motifs
Structural PredictionAlphaFold, I-TASSER, Phyre2Predict 3D structure to infer function
Genomic ContextSTRING, MicrobesOnlineAnalyze gene neighborhood and operons
Phylogenetic ProfilingPhyloPro, CLIMEIdentify co-evolved gene families
Transcriptional Co-regulationRegulonDB, DOORFind genes with similar expression patterns
Network-based InferenceGeneMANIA, FunCoupPredict function based on interaction networks
Literature MiningPubTator, EVEXExtract knowledge from published research

For minimal organisms like M. pneumoniae, genomic context analysis is particularly valuable. For example, researchers discovered that genes regulated by the glycerophosphodiesterase GlpQ all contain a conserved potential cis-acting element upstream of their coding regions . Similar regulatory patterns might exist for genes related to MPN_274.

Integration of multiple predictive approaches typically yields more reliable results than any single method. The confidence in functional predictions increases when multiple independent methods converge on similar functions.

How might systems biology approaches advance understanding of uncharacterized proteins in minimal genomes?

Systems biology offers powerful approaches to understand uncharacterized proteins in minimal genomes through:

  • Multi-omics integration methodologies:

    • Correlation of transcriptomics, proteomics, metabolomics, and phosphoproteomics data

    • Network reconstruction to identify functional modules

    • Identification of condition-specific regulatory patterns

  • Genome-scale metabolic modeling:

    • Prediction of metabolic capabilities and requirements

    • In silico gene knockouts to predict essentiality

    • Flux balance analysis to identify metabolic bottlenecks

  • Protein-protein interaction mapping:

    • Comprehensive interactome analysis using yeast two-hybrid or proximity labeling

    • Identification of protein complexes and functional clusters

    • Correlation of interaction patterns with phosphorylation states

  • Comparative systems biology:

    • Cross-species comparison of minimal genomes (e.g., M. pneumoniae vs. M. genitalium)

    • Identification of conserved vs. species-specific functions

    • Evolutionary trajectory reconstruction

For MPN_274, a systems biology approach would integrate its phosphorylation status, interaction partners, expression patterns, and evolutionary conservation to develop hypotheses about its function. The bacterial two-hybrid approach has already revealed that glycolysis in M. pneumoniae involves a structured interaction network with the enolase acting as a central hub . Similar network analysis could reveal whether MPN_274 participates in known cellular pathways.

What are the most promising approaches for studying proteins that resist conventional characterization methods?

For proteins that resist conventional characterization methods, several innovative approaches show promise:

  • Proximity-dependent labeling:

    • BioID or TurboID fusion proteins to identify neighboring proteins in vivo

    • APEX2 for subcellular localization and interaction mapping

    • Identification of functional context through "guilt by association"

  • Cryo-electron tomography:

    • Direct visualization of proteins in their native cellular context

    • Correlation with fluorescence microscopy for protein identification

    • Structural determination within the cellular environment

  • Single-molecule approaches:

    • FRET to study conformational changes and interactions

    • Single-molecule tracking to determine localization and dynamics

    • Optical tweezers to measure mechanical properties

  • Chemical biology methods:

    • Activity-based protein profiling to identify functional activities

    • Photo-crosslinking to capture transient interactions

    • Metabolic labeling to track protein synthesis and turnover

  • Advanced genetic approaches:

    • CRISPRi for partial knockdown of essential genes

    • Synthetic genetic arrays to identify genetic interactions

    • Suppressor screening to identify functional relationships

For studying MPN_274, which is still uncharacterized, researchers might consider creating fusion proteins for proximity labeling to identify its interaction network within living cells. The small genome size of M. pneumoniae makes it feasible to screen for genetic interactions systematically, potentially revealing functional relationships that aren't apparent through direct characterization methods.

How can contradictory findings about minimal organism protein function be reconciled methodologically?

Reconciling contradictory findings about protein function in minimal organisms requires a structured methodological approach:

  • Standardized experimental protocols:

    • Development of community-agreed standard operating procedures

    • Detailed reporting of all experimental conditions

    • Use of common reference strains and materials

  • Multi-laboratory validation studies:

    • Collaborative projects with identical protocols across labs

    • Blind analysis of samples prepared in different laboratories

    • Meta-analysis of published data with attention to methodological differences

  • Integration of complementary techniques:

    • Validation of findings using orthogonal methods

    • Combination of in vitro and in vivo approaches

    • Integration of genetic, biochemical, and computational evidence

  • Context-dependent functional analysis:

    • Testing function under various physiological conditions

    • Consideration of genetic background effects

    • Analysis of potential moonlighting functions

  • Advanced statistical approaches:

    • Bayesian integration of conflicting evidence

    • Sensitivity analysis to identify critical parameters

    • Meta-analysis methodologies adapted for molecular biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.