Recombinant Mycoplasma pneumoniae Uncharacterized protein MG135 homolog (MPN_276)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_276; A65_orf285; MP559; Uncharacterized protein MG135 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_276
Target Protein Sequence
MQSLNYLVVILTVAGVLVILGFTPLIRKLKIQFYCLQVFAAILFLYVFFGRQIIYIFPDI YGTAAKAKNAVANVPLDSLRLSRIFLLDLCPFFALIGPIFIFLRQKKVAGVLAIFGFYGA AITLFGELIFTPLKQEEIVKFLFVGLENNQVYFMMHFLSFLLSLAVFLWDDGFSLISFFY IHVFALAYLSYVALMVNIFKGQITGNTTGILAEDWLSGEYKNVAVFLKLDPKNADLIFGV SFGLSYFAIVLLTVLVNIPTFIQLTKDKQMVKLALQLKKAQASVA
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN276

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MPN_276 protein and what is its relationship to MG135?

MPN_276 is an uncharacterized protein in Mycoplasma pneumoniae that is homologous to the MG135 protein found in other Mycoplasma species. It belongs to a group of adhesion-related proteins that may play a role in the pathogenicity of M. pneumoniae. To study this relationship, researchers typically employ homology analysis approaches similar to those used for other M. pneumoniae proteins.

To identify homology relationships, researchers can use NCBI's HomoloGene database by searching with the gene name or protein accession number . If direct searches don't yield results, alternative approaches include searching the Gene database and following links to HomoloGene, or using BLAST searches with the protein sequence to identify similar proteins across different organisms .

What experimental models are suitable for studying MPN_276 function?

When studying MPN_276, researchers typically utilize several experimental models, similar to those employed for other M. pneumoniae proteins. These include recombinant expression systems in influenza virus vectors, which have been successfully used for other M. pneumoniae proteins such as P1 and P30 .

The methodology involves inserting the gene of interest into a vector (similar to how P1a and P30a genes were inserted into the nonstructural protein gene of Influenza A virus) . Following gene insertion, the recombinant plasmids are cotransfected with the remaining viral genome fragments into HEK293T cells, and the resulting recombinant viruses are propagated in chicken embryos . This approach allows for stable expression of the protein of interest while maintaining the genetic stability of the recombinant construct through multiple passages .

How can I verify successful cloning of MPN_276 into an expression vector?

Verification of successful MPN_276 cloning uses methods similar to those demonstrated for other M. pneumoniae proteins. The process includes:

  • Reverse Transcription-Polymerase Chain Reaction (RT-PCR) using gene-specific primers designed to amplify the inserted MPN_276 sequence .

  • Confirmation of insertion by observing bands of expected size on gel electrophoresis (the exact size would depend on the MPN_276 sequence length) .

  • Sanger sequencing of the amplified product to verify the correct sequence has been inserted without mutations .

For example, in similar work with P1a and P30a genes, RT-PCR identification confirmed successful insertion by showing bands at the expected positions (P1a at 693 bp and P30a at 774 bp) . Following this approach, MPN_276 insertion would be confirmed by identifying a band corresponding to its expected size, followed by sequence verification.

What strategies can I use to improve expression yields of recombinant MPN_276?

Optimizing expression yields of recombinant MPN_276 requires consideration of several factors based on approaches used for similar M. pneumoniae proteins:

  • Vector selection: The pHW2000 plasmid system has shown success for influenza virus-based expression of M. pneumoniae proteins . This system allows for efficient transcription of viral RNA and subsequent protein expression.

  • Host cell optimization: HEK293T cells have demonstrated efficacy for initial transfection and protein expression, while propagation in chicken embryos provides a suitable environment for viral replication and protein production .

  • Expression conditions: Monitoring hemagglutination titers through successive generations (as performed with rFLU-P1a and rFLU-P30a) can help optimize culture conditions and harvest timing . For those recombinant viruses, titers stabilized at approximately 1:128 and 1:32 respectively, indicating successful propagation .

  • Genetic stability: Testing the genetic stability of the recombinant construct through multiple passages (at least five) is critical to ensure consistent expression over time . This can be verified through repeated RT-PCR confirmation of the inserted gene after each passage.

For MPN_276 specifically, researchers should consider codon optimization for the host system and carefully monitor protein expression levels throughout the production process.

How can I design experiments to study potential interactions between MPN_276 and host immune response?

Designing experiments to study MPN_276-host immune interactions should follow a structured approach:

  • Recombinant Expression System Selection:

    • Use an influenza virus vector system similar to that employed for P1 and P30 genes, which successfully maintained genetic stability through multiple passages .

    • Consider that these systems allow for intranasal administration, which is particularly relevant for respiratory pathogens like M. pneumoniae .

  • Immunogenicity Assessment Protocol:

    • Design a multi-phase experimental protocol that includes:
      a) In vitro studies with human immune cells
      b) Animal model studies (typically mice) with varied dosing schedules
      c) Analysis of both humoral and cell-mediated immune responses

  • Data Analysis Strategy:

    • Implement statistical methods to determine significance in immune response measurements

    • Use appropriate controls, including wild-type influenza virus and non-recombinant M. pneumoniae

    • Apply experimental design principles that account for variability in immune responses

  • Safety Monitoring:

    • Monitor for potential pathogenic effects in experimental models

    • Assess genetic stability through multiple passages to ensure consistent antigen presentation

This approach leverages the documented success of recombinant influenza virus vectors for expressing M. pneumoniae antigens while providing a comprehensive assessment of host immune interactions.

What are the challenges in differentiating between MPN_276 and other similar proteins during analysis?

Differentiating MPN_276 from similar proteins presents several technical challenges that require sophisticated approaches:

  • Sequence Similarity Issues:

    • Uncharacterized proteins often share sequence similarities that can complicate identification

    • Employ multiple sequence alignment tools with varied algorithms to improve discrimination

    • Use position-specific scoring matrices rather than simple sequence comparison

  • Structural Analysis Approach:

    • Predict protein structures using multiple modeling approaches

    • Compare predicted structural domains for functional differentiation

    • Utilize structural alignment tools to identify subtle differences not apparent in sequence comparison

  • Experimental Verification Strategy:

    • Develop highly specific antibodies against unique epitopes of MPN_276

    • Implement epitope mapping to identify unique regions for targeted analysis

    • Use mass spectrometry with peptide fingerprinting to distinguish between closely related proteins

  • Homology Identification Protocol:

    • Follow NCBI's systematic approach for homolog identification starting with protein sequence

    • Use protein BLAST with carefully adjusted parameters to differentiate closely related proteins

    • Apply phylogenetic analysis to establish evolutionary relationships with similar proteins

These methodological approaches can help researchers overcome the challenges inherent in studying proteins with high sequence or structural similarity to the target protein of interest.

How should I design experiments to characterize the function of MPN_276?

Designing experiments to characterize MPN_276 function requires a systematic approach based on successful methods used for other M. pneumoniae proteins:

  • Expression System Selection:

    • Recombinant expression in an influenza virus vector system has demonstrated success for M. pneumoniae proteins

    • This system allows for stable expression through multiple generations, maintaining genetic integrity

  • Functional Characterization Protocol:

    • Begin with subcellular localization studies to determine protein distribution

    • Perform protein-protein interaction studies using co-immunoprecipitation and yeast two-hybrid assays

    • Conduct knockout/knockdown studies to observe phenotypic changes

    • Implement complementation assays to confirm observed phenotypes

  • Experimental Design Framework:

    • Apply systematic experimental design principles that control for variables and potential confounding factors

    • Include appropriate positive and negative controls at each experimental stage

    • Use statistical methods appropriate for the data type generated

  • Data Validation Strategy:

    • Validate findings using multiple orthogonal techniques

    • Implement both in vitro and in vivo systems for comprehensive functional assessment

    • Apply both genetic and biochemical approaches to confirm observations

This structured approach ensures comprehensive characterization while minimizing experimental bias and enhancing reproducibility of results.

What controls should be included when studying MPN_276 expression and function?

A robust experimental design for studying MPN_276 requires carefully selected controls:

  • Positive Controls:

    • Well-characterized M. pneumoniae proteins (such as P1 or P30) that have established expression patterns and functions

    • Recombinant constructs with known stable expression characteristics in the chosen system

    • Standardized protein samples with confirmed identity and activity for assay validation

  • Negative Controls:

    • Empty vector constructs processed identically to MPN_276-containing vectors

    • Non-relevant proteins expressed in the same system to control for vector effects

    • Host cells without recombinant constructs to establish baseline measurements

  • Technical Controls:

    • RT-PCR controls to verify specificity of primers and absence of contamination

    • Sequencing confirmation at multiple stages to verify construct integrity

    • Passage stability controls to ensure consistent expression across generations

  • Biological Replicates:

    • Multiple independent transformations/transfections to account for transformation variability

    • Repeated measurements across different experimental batches

    • Biological replicates from different starting cultures or embryos

For example, when working with recombinant influenza viruses, control experiments should include wild-type influenza virus without inserted genes, along with monitoring hemagglutination titers to confirm virus viability and stability through multiple passages .

How can I ensure reproducibility in MPN_276 experimental studies?

Ensuring reproducibility in MPN_276 studies requires adherence to several methodological principles:

  • Standardized Protocols:

    • Develop detailed protocols that specify all experimental parameters, including:
      a) Precise vector construction methodology
      b) Standardized transfection conditions for HEK293T cells
      c) Consistent chicken embryo inoculation procedures
      d) Uniform viral harvest and purification methods

  • Quality Control Measures:

    • Implement systematic quality checks at critical stages:
      a) RT-PCR verification of gene insertion with appropriate controls
      b) Sequencing confirmation of construct integrity
      c) Hemagglutination titer assessment for viral viability
      d) Electron microscopy verification of virus morphology

  • Data Management Strategy:

    • Maintain comprehensive records of all experimental conditions

    • Document all deviations from established protocols

    • Implement data validation procedures before analysis

    • Use experimental design principles that support statistical validity

  • Validation Across Systems:

    • Verify key findings using alternative expression systems

    • Test reproducibility across different laboratories when possible

    • Confirm observations using complementary analytical techniques

How should I analyze the genetic stability of recombinant MPN_276 constructs?

Analyzing genetic stability of recombinant MPN_276 constructs should follow established approaches used for similar M. pneumoniae proteins:

  • Passage Stability Protocol:

    • Conduct multiple consecutive passages in chicken embryos (minimum five passages recommended)

    • Harvest virus after each passage and extract RNA for analysis

    • Perform RT-PCR with MPN_276-specific primers to verify continued presence of the inserted gene

    • Sequence key regions after multiple passages to detect potential mutations or deletions

  • Functional Stability Assessment:

    • Monitor hemagglutination titers across passages as an indicator of viral fitness and stability

    • Compare growth characteristics between early and late passages

    • Assess protein expression levels throughout multiple passages

    • Evaluate morphological characteristics using electron microscopy

  • Statistical Analysis Approach:

    • Apply appropriate statistical methods to determine significance of any observed changes

    • Account for normal variation in viral titers and growth characteristics

    • Implement experimental design principles that allow for meaningful statistical analysis

For example, in similar work with rFLU-P1a and rFLU-P30a, researchers found that hemagglutination titers remained stable at approximately 1:128 and 1:32 respectively through five passages, indicating good genetic stability . Similar stability metrics should be established for MPN_276 constructs.

What bioinformatic approaches are most appropriate for analyzing MPN_276 homology relationships?

When analyzing MPN_276 homology relationships, researchers should implement a comprehensive bioinformatic approach:

  • Sequence-Based Homology Analysis:

    • Begin with NCBI's HomoloGene database, searching with the gene name or protein accession number

    • Utilize the Gene database if HomoloGene searches are unsuccessful, following links to identify potential homologs

    • Implement protein BLAST searches when other approaches yield limited results

    • Adjust BLAST parameters (substitution matrices, gap penalties) for optimal sensitivity

  • Structural Homology Assessment:

    • Generate predicted protein structures using multiple modeling approaches

    • Perform structural alignment with potential homologs

    • Identify conserved domains that may indicate functional similarities

    • Calculate structural similarity scores to quantify relationships

  • Phylogenetic Analysis:

    • Construct multiple sequence alignments with potential homologs

    • Build phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate evolutionary distances to estimate relatedness

    • Map sequence conservation across related proteins to identify functional domains

  • Functional Annotation Transfer:

    • Identify well-characterized homologs in other organisms

    • Assess conservation of key functional residues

    • Evaluate synteny and genomic context across species

    • Implement Gene Ontology enrichment analysis for functional prediction

These approaches can be systematically applied following NCBI's recommended workflow for homolog identification, starting with database searches and progressing to more sophisticated analyses as needed .

How can I integrate experimental data with computational predictions for MPN_276?

Integrating experimental data with computational predictions for MPN_276 requires a multi-faceted approach:

  • Data Integration Framework:

    • Develop a systematic protocol for combining experimental observations with in silico predictions

    • Establish clear criteria for resolving discrepancies between experimental and computational results

    • Implement data normalization procedures to allow direct comparison across methodologies

    • Apply experimental design principles that facilitate meaningful integration

  • Validation Strategy:

    • Use experimental data to validate computational predictions of protein characteristics

    • Compare observed expression patterns with predicted regulatory elements

    • Verify predicted protein-protein interactions through experimental methods

    • Test predicted functional domains through targeted mutagenesis

  • Iterative Refinement Process:

    • Apply initial computational predictions to guide experimental design

    • Refine computational models based on experimental outcomes

    • Develop improved predictions incorporating experimental constraints

    • Test refined predictions with targeted experimental approaches

  • Visualization and Analysis Tools:

    • Implement integrated visualization platforms to simultaneously display experimental and computational data

    • Utilize statistical methods appropriate for heterogeneous data types

    • Apply machine learning approaches to identify patterns across multiple data sources

    • Develop custom analytical pipelines specific to MPN_276 characteristics

How can I overcome challenges in purifying recombinant MPN_276 protein?

Purification of recombinant MPN_276 presents several technical challenges, which can be addressed using approaches similar to those employed for other M. pneumoniae proteins:

  • Expression System Optimization:

    • Select an appropriate expression system based on protein characteristics

    • Consider the influenza virus vector system which has shown success for M. pneumoniae proteins

    • Optimize expression conditions to maximize yield while maintaining protein integrity

    • Monitor genetic stability through multiple passages to ensure consistent protein production

  • Purification Protocol Development:

    • Implement a multi-step purification strategy:
      a) Initial capture using affinity chromatography (if tagged protein is used)
      b) Intermediate purification using ion exchange chromatography
      c) Final polishing using size exclusion chromatography

    • Validate each purification step using analytical techniques such as SDS-PAGE and Western blot

  • Solubility Enhancement Strategies:

    • Test multiple buffer conditions to optimize protein solubility

    • Consider fusion partners known to enhance solubility

    • Evaluate detergent screening for membrane-associated proteins

    • Implement on-column refolding for proteins prone to aggregation

  • Quality Control Measures:

    • Verify protein identity using mass spectrometry

    • Confirm structural integrity using circular dichroism

    • Assess homogeneity using dynamic light scattering

    • Validate functional activity using appropriate bioassays

These systematic approaches can help overcome the common challenges associated with purifying recombinant proteins from M. pneumoniae.

What strategies can address the problem of low immunogenicity in MPN_276 studies?

Addressing low immunogenicity issues with MPN_276 requires strategies similar to those developed for other M. pneumoniae proteins:

  • Adjuvant Selection Strategy:

    • Test multiple adjuvant formulations to enhance immune response

    • Consider novel adjuvants specifically designed for mucosal immunity

    • Evaluate dose-response relationships for optimal adjuvant concentration

    • Assess potential adjuvant-related side effects

  • Immunization Protocol Optimization:

    • Implement prime-boost strategies with varied time intervals

    • Test multiple routes of administration (intranasal, intramuscular, subcutaneous)

    • Evaluate the influence of antigen dose on immune response

    • Consider heterologous prime-boost approaches with different delivery systems

  • Antigen Presentation Enhancement:

    • Utilize viral vector systems for improved antigen presentation, similar to the influenza vector approach used for other M. pneumoniae proteins

    • Consider virus-like particles for multivalent antigen display

    • Evaluate targeted delivery systems for improved uptake by antigen-presenting cells

    • Test co-delivery of immune stimulatory molecules

  • Assessment Protocol Design:

    • Implement comprehensive immune response analysis:
      a) Antibody titers and affinity measurements
      b) T-cell response evaluation (both CD4+ and CD8+)
      c) Cytokine profile analysis
      d) Mucosal immunity assessment

These approaches can overcome the poor immunogenicity problems that have historically challenged M. pneumoniae vaccine development efforts, as noted in research on other M. pneumoniae proteins .

What are promising future research directions for MPN_276 characterization?

Several promising research directions for MPN_276 characterization emerge from current methodologies:

  • Structural Biology Approaches:

    • Determine the three-dimensional structure using X-ray crystallography or cryo-EM

    • Compare structural features with known homologs to identify functional domains

    • Perform molecular dynamics simulations to understand conformational flexibility

    • Map potential interaction sites through computational prediction and validation

  • Multi-Omics Integration:

    • Combine transcriptomic, proteomic, and metabolomic data to place MPN_276 in cellular networks

    • Apply systems biology approaches to understand protein function in the context of M. pneumoniae physiology

    • Implement experimental design principles that support integrated data analysis

    • Develop computational models that predict functional interactions

  • Host-Pathogen Interaction Studies:

    • Investigate the role of MPN_276 in infection and colonization

    • Assess potential as a vaccine candidate using recombinant expression approaches similar to those used for P1 and P30

    • Study immunological responses to MPN_276 in various models

    • Evaluate potential as a diagnostic biomarker

  • Therapeutic Targeting Potential:

    • Assess MPN_276 as a potential drug target

    • Screen for small molecules that interact with MPN_276

    • Develop inhibitors based on structural information

    • Test efficacy of targeting approaches in infection models

These research directions build upon established methodologies while expanding our understanding of this uncharacterized protein.

How might new technologies improve our understanding of MPN_276 function?

Emerging technologies offer significant potential to advance MPN_276 research:

  • Advanced Structural Biology Techniques:

    • Implement AlphaFold or similar AI-based structure prediction tools for more accurate models

    • Utilize high-resolution cryo-EM for structural determination without crystallization

    • Apply hydrogen-deuterium exchange mass spectrometry to map protein dynamics

    • Implement single-molecule biophysical techniques to study conformational changes

  • Gene Editing and Synthetic Biology:

    • Apply CRISPR-Cas systems optimized for M. pneumoniae to create precise mutations

    • Develop minimal synthetic systems to study MPN_276 function in controlled environments

    • Create reporter systems for real-time monitoring of protein expression and localization

    • Implement optogenetic approaches for temporal control of protein function

  • Advanced Imaging Technologies:

    • Utilize super-resolution microscopy to study subcellular localization

    • Implement correlative light and electron microscopy for structural context

    • Apply live-cell imaging techniques to monitor dynamics in real-time

    • Develop fluorescent biosensors to detect protein-protein interactions

  • Computational Integration Platforms:

    • Implement machine learning approaches for integrating heterogeneous data types

    • Develop predictive models of protein function based on multi-omics data

    • Apply network analysis tools to place MPN_276 in biological pathways

    • Utilize experimental design principles that maximize the value of computational analyses

These technological advances, when applied to MPN_276 research, promise to provide deeper insights into protein function and significance in M. pneumoniae biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.