Recombinant Mycoplasma pneumoniae Uncharacterized protein MG144 homolog (MPN_157)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MPN_157; MP674; VXpSPT7_orf402; Uncharacterized protein MG144 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_157
Target Protein Sequence
MKPPKKPVNPPFGKLTDSKAGVVKATSSQETKKVADTKPKNKGGLFSFFKKDKTEKPAKA AKPKDAFKSAIAELNPKANPKTVKADVAPAKIPHSDKGTVTPVELKPQTEAPLPPGVKQP DPKKDKPKGGLFGFFKKDKNKDVKKEPAKPATPVKTEPTSPKVEPTKVKPPGGVPTKPVV EKPVSAQPTVPLQPEPTFPVKAAPLPPGVKAEPESKKRFGLFKAFQKDDAKQPKQKLNLQ DQQDRFIDDPTAKKHFSAFNQKVGNLLKDKKTRNRDWKIVGWIHGLILLFFIPLLAIMNK FVTLPAQSYPAVSLQVSINNALWGIAIFVIANIALPFITMFVLFLTGVRDVHASRPVHYF IWVLMLLNLTFLVISCCLLAAAYANLDLYNIWRNLQALDPNN
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN157

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the known basic properties of MPN_157?

MPN_157 (UniProt ID: P75588) is an uncharacterized protein from Mycoplasma pneumoniae with the following physical properties:

  • Protein length: 402 amino acids

  • Molecular weight: 44.3 kDa

  • Isoelectric point (pI): 10.0

  • Aliases: Uncharacterized protein MG144 homolog

The protein has membrane-spanning domains with both predicted membrane association (Y) and potential surface exposure (Y) as indicated in proteomic studies . The high pI suggests a positively charged protein at physiological pH, which may indicate nucleic acid binding capability or surface interactions.

What bioinformatic approaches can help predict MPN_157 function?

To predict the function of MPN_157, researchers should employ a multi-faceted bioinformatic approach:

  • Sequence-based analysis:

    • PSI-BLAST and HHpred for distant homolog detection

    • PFAM and InterPro for domain identification

    • TMHMM for transmembrane region prediction

    • SignalP for signal peptide prediction

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structural modeling

    • Structural comparison with PDBeFold or DALI

  • Genomic context analysis:

    • Examining neighboring genes in the M. pneumoniae genome

    • Synteny analysis with related mycoplasma species

This approach is essential since M. pneumoniae has a highly conserved genome with 624 (66.6%) conserved homologs present in 100% of all M. pneumoniae isolates, suggesting functional importance for conserved proteins .

How conserved is MPN_157 across Mycoplasma species?

  • The total pan-genome of M. pneumoniae consists of 937 homologous genes

  • 624 genes (66.6%) form the core genome conserved across all isolates

To determine MPN_157 conservation:

  • Perform multiple sequence alignment of MPN_157 across different M. pneumoniae strains

  • Compare with the MG144 homolog in M. genitalium (79% amino acid identity between many homologous proteins in these species)

  • Search for homologs in other mycoplasma species using bidirectional best hit analysis

Given the role of recombination in mycoplasma evolution mediated by RecA homologs , sequence variation analysis of MPN_157 may provide insights into selective pressures on this protein.

What expression systems are optimal for producing recombinant MPN_157?

Based on successful expression of other M. pneumoniae proteins, the following approach is recommended:

Recommended expression system:

  • Host: E. coli BL21(DE3) or derivatives

  • Vector: pET-11c or similar T7-based expression vectors

  • Tags: N-terminal or C-terminal His-tag for purification

  • Growth conditions: Culture at lower temperatures (16-20°C) to improve folding

Important considerations:

  • Check for rare codons in the MPN_157 sequence that might require codon optimization or special E. coli strains

  • Verify the MPN_157 sequence has no UGA codons, which encode tryptophan in mycoplasmas but are stop codons in E. coli

  • For membrane proteins, specialized approaches may be needed:

    • Use of E. coli C41(DE3) or C43(DE3) strains

    • Addition of mild detergents during extraction

    • Membrane-targeted tags (like PelB leader sequence)

This approach has been successful for expressing related M. pneumoniae proteins including RecA homologs .

What purification strategies are most effective for recombinant MPN_157?

Based on successful purification of other M. pneumoniae proteins, a multi-step purification strategy is recommended:

Purification protocol:

  • Initial extraction:

    • For soluble proteins: Lysis in low-salt buffer, followed by centrifugation

    • For membrane-associated proteins: Extraction with high-salt buffer (0.5-1M NaCl) after initial centrifugation

  • Affinity chromatography options:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Heparin Sepharose affinity (especially for nucleic acid-binding proteins)

  • Secondary purification:

    • Ion-exchange chromatography (considering pI 10.0, cation exchange at pH 7-8)

    • Size exclusion chromatography for final polishing and buffer exchange

This multi-step approach has been used successfully for purifying RecA homologs from M. pneumoniae to near-homogeneity .

How can researchers validate antibodies against poorly characterized proteins like MPN_157?

Comprehensive antibody validation protocol:

  • Initial validation:

    • Western blot against recombinant protein and M. pneumoniae lysates

    • Peptide competition assay to confirm specificity

    • Test against knockout strains if available (challenging in M. pneumoniae)

  • Specificity assessment:

    • Test cross-reactivity with M. genitalium lysates (containing MG144)

    • Preabsorption with recombinant protein to eliminate specific binding

  • Functional validation:

    • Immunofluorescence microscopy to verify predicted localization

    • Immunoprecipitation followed by mass spectrometry to confirm target

    • Binding inhibition assays if protein function becomes known

Similar approaches have been used to validate antibodies against M. pneumoniae adhesion proteins and RecA homologs .

What techniques can determine if MPN_157 is exposed on the bacterial surface?

To determine surface exposure of MPN_157, use a multi-technique approach:

Experimental strategy:

  • Surface proteomics:

    • Surface biotinylation with membrane-impermeable reagents followed by avidin purification and LC-MS/MS analysis

    • Surface shaving with proteases followed by MS identification of released peptides

  • Immunological approaches:

    • Flow cytometry with intact bacteria using anti-MPN_157 antibodies

    • Immunogold electron microscopy to visualize protein localization

    • Whole-cell ELISA with intact vs. lysed cells

  • Functional approaches:

    • Surface accessibility assays using proteases

    • Surface binding assays to potential host molecules

This approach has been used for other M. pneumoniae surface proteins like the adhesin P1 and P40/P90 proteins, which are important for host cell attachment .

What methods can identify potential binding partners of MPN_157?

To identify binding partners of MPN_157, employ both in vitro and cell-based approaches:

Recommended techniques:

  • Protein-protein interaction screening:

    • GST pull-down assays with cell lysates (as used for NOD2-interacting M. pneumoniae proteins)

    • Co-immunoprecipitation from M. pneumoniae lysates

    • Yeast two-hybrid screening

    • Protein microarrays with human proteins

  • Host interaction studies:

    • Binding assays with human cell lines (e.g., A549 respiratory cells)

    • Microscale thermophoresis to measure binding affinities

    • Surface plasmon resonance (SPR) for kinetic analysis

    • ELISA-based binding assays to ECM components

  • Validation approaches:

    • Competitive inhibition with recombinant fragments

    • Antibody blocking experiments

    • Mutagenesis of predicted binding sites

These methods have successfully identified interactions between other M. pneumoniae proteins and host molecules, such as elongation factor Tu binding to plasminogen and fibronectin .

How can researchers assess potential roles of MPN_157 in M. pneumoniae pathogenesis?

To investigate potential roles in pathogenesis, integrate molecular and cellular approaches:

Experimental strategy:

  • Infection models:

    • Human respiratory epithelial cell infection assays

    • Air-liquid interface cultures of primary human bronchial cells

    • Animal models (guinea pig models have been used for M. pneumoniae)

  • Functional assays:

    • Adhesion inhibition assays with anti-MPN_157 antibodies

    • Cytokine induction measurement in infected cells

    • Inflammatory response assessment (NOD2/RIP2/NF-κB pathway activation)

  • Molecular approaches:

    • Targeted gene knockdown/knockout if possible (challenging in M. pneumoniae)

    • Heterologous expression in non-pathogenic bacteria

    • Blocking with recombinant protein or antibodies during infection

Similar approaches identified that DUF16 protein from M. pneumoniae can enter macrophages and induce inflammatory responses via the NOD2/RIP2/NF-κB pathway .

What is known about the genomic organization around MPN_157?

The genomic context of MPN_157 should be analyzed to understand its potential functional relationships:

  • Genomic neighborhood analysis:

    • Identify adjacent genes and their functions

    • Look for potential operonic structures

    • Determine if MPN_157 is located near any known virulence factors

  • Comparative genomics approach:

    • Compare synteny (gene order conservation) with M. genitalium and other mycoplasmas

    • Analyze if MPN_157 is located near any RepMP elements, which are involved in antigenic variation in M. pneumoniae

    • Determine if MPN_157 is located in a region with atypical GC content, suggesting horizontal gene transfer

M. pneumoniae has a compact 816-kb genome with approximately 8% composed of repetitive DNA elements (RepMP1, RepMP2/3, RepMP4, and RepMP5) , making genomic context analysis particularly important.

Could MPN_157 be involved in antigenic variation in M. pneumoniae?

To investigate potential involvement in antigenic variation:

  • Sequence analysis:

    • Check if MPN_157 contains any RepMP elements or fragments

    • Compare sequence across clinical isolates for evidence of recombination

    • Analyze for homology to known variable surface proteins

  • Recombination analysis:

    • Look for evidence of RecA-mediated recombination events in the MPN_157 region

    • Use MLVA (Multiple-Locus Variable-number tandem-repeat Analysis) to characterize strain variability

    • Compare sequences across different P1 adhesin type strains

  • Immunological evidence:

    • Test patient sera from different time points for reactivity

    • Analyze immunodominant epitopes for variability

The mechanism for antigenic variation in M. pneumoniae involves RecA-mediated homologous recombination between RepMP elements . If MPN_157 is subject to similar variation, it might contribute to immune evasion.

How can single-cell approaches be applied to study MPN_157 function during infection?

Advanced single-cell techniques offer new insights into protein function:

Cutting-edge methodologies:

  • Single-cell RNA-seq applications:

    • Dual RNA-seq of infected host cells to correlate MPN_157 expression with host response

    • Trajectory analysis to map temporal changes during infection

    • Cell-type specific responses to M. pneumoniae expressing MPN_157

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize MPN_157 localization

    • Live-cell imaging with fluorescently tagged MPN_157

    • Correlative light and electron microscopy for ultrastructural context

  • Single-cell proteomics:

    • Mass cytometry (CyTOF) with anti-MPN_157 antibodies

    • Proximity labeling methods (BioID, APEX) to identify interacting proteins in situ

    • Single-cell Western blot to analyze variability in expression

These approaches could reveal heterogeneity in host cell responses to MPN_157 during infection, similar to variable pulmonary patterns seen in M. pneumoniae infections .

What structural biology approaches are suitable for membrane-associated mycoplasma proteins like MPN_157?

For structural characterization of membrane-associated proteins:

Recommended structural biology pipeline:

  • Sample preparation approaches:

    • Detergent screening for optimal solubilization

    • Nanodiscs or amphipols for membrane protein stabilization

    • Lipid cubic phase crystallization for membrane proteins

  • Structural determination methods:

    • Cryo-electron microscopy for large complexes

    • X-ray crystallography for high-resolution structures

    • NMR for dynamic regions and smaller domains

    • AlphaFold2-based modeling with experimental validation

  • Functional validation:

    • Site-directed mutagenesis of predicted functional sites

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Surface plasmon resonance for interaction studies

This multi-technique approach has been successful for other bacterial membrane proteins and could be adapted for MPN_157 characterization.

How can genetic manipulation systems be optimized for studying MPN_157 function in M. pneumoniae?

Genetic manipulation in M. pneumoniae remains challenging but several approaches show promise:

Genetic toolbox development:

  • Gene knockout/knockdown strategies:

    • Transposon mutagenesis with mini-transposons

    • CRISPR-Cas9 system optimization for mycoplasmas

    • Antisense RNA approaches for knockdown

    • Conditional expression systems

  • Reporter systems:

    • Promoter-reporter fusions to study MPN_157 expression

    • Protein fusion constructs for localization studies

    • Split-reporter systems for interaction studies

  • Complementation approaches:

    • Ectopic expression of MPN_157 variants

    • Expression in heterologous mycoplasma species

    • Trans-complementation with plasmid-based systems

The successful characterization of RecA-deficient strains in related mycoplasma species (Acholeplasma laidlawii and Mycoplasma pulmonis) demonstrating DNA repair-deficient phenotypes provides a template for similar genetic approaches with MPN_157 .

How might expression of MPN_157 correlate with different clinical presentations of M. pneumoniae infection?

To investigate potential associations with clinical outcomes:

Research approach:

  • Clinical sample analysis:

    • Quantitative PCR for MPN_157 expression in patient samples

    • Correlation with disease severity metrics

    • Comparison between upper and lower respiratory tract infections

  • Strain variation analysis:

    • Compare MPN_157 sequence across clinical isolates with different:

      • Macrolide resistance profiles (currently 96% resistance in some regions)

      • P1 adhesin types (P1-type 1 currently dominant at 88.98%)

      • MLVA types (M4-5-7-2 being the predominant genotype)

  • Host-response correlation:

    • Analysis of antibody responses to MPN_157 in patient sera

    • Cytokine profiles in relation to MPN_157 expression

    • T-cell responses to MPN_157 epitopes

M. pneumoniae typically produces a mild "walking pneumonia" but can trigger exacerbation of other lung diseases including bronchitis, asthma, COPD, and cystic fibrosis . The role of specific proteins like MPN_157 in these variable presentations warrants investigation.

What techniques can identify potential associations between MPN_157 variants and antimicrobial resistance?

To investigate potential links to resistance:

Methodological approach:

  • Genomic correlation studies:

    • Whole genome sequencing of resistant isolates

    • SNP analysis of MPN_157 in relation to 23S rRNA mutations (A2063G)

    • Pan-genome analysis to identify co-occurring mutations

  • Functional studies:

    • Recombinant expression of MPN_157 variants

    • Drug interaction studies in vitro

    • Heterologous expression in susceptible strains

  • Clinical surveillance:

    • MLVA typing of isolates from treatment failures

    • Temporal analysis of MPN_157 sequences during treatment

    • Geographic distribution of variants in high-resistance regions

The extremely high macrolide resistance rate (96% in some regions, all with A2063G mutation in 23S rRNA) makes understanding potential accessory mechanisms important.

Protein NomenclatureFull Protein NameLength (aa)MW (kDa)pIPredicted Membrane AssociationSurface Exposed
MPN_157Uncharacterized protein MG144 homolog40244.310.0YesYes

Table 1: Basic properties of MPN_157 protein from Mycoplasma pneumoniae

The systematic analysis of MPN_157 using these research approaches will contribute to our understanding of M. pneumoniae pathogenesis and potentially identify new targets for intervention against this significant respiratory pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.