Recombinant Mycoplasma pneumoniae Uncharacterized protein MG147 homolog (MPN_160)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG147 Homolog (MPN_160)

Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG147 Homolog (MPN_160) is a recombinant protein derived from the bacterium Mycoplasma pneumoniae. This protein is homologous to the MG147 protein and is encoded by the gene MPN_160. It is expressed in Escherichia coli and is available with an N-terminal His tag for easy purification and detection .

Key Features:

  • Species: Mycoplasma pneumoniae

  • Source: Expressed in Escherichia coli

  • Tag: N-terminal His tag

  • Protein Length: Full length, spanning 1-377 amino acids

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage Buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

Applications:

  • SDS-PAGE: Used for protein analysis and purity assessment.

  • Research: Useful in studying the biology of Mycoplasma pneumoniae and its interactions with host cells.

Table: Key Information on Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG147 Homolog (MPN_160)

CharacteristicDescription
SpeciesMycoplasma pneumoniae
SourceEscherichia coli
TagN-terminal His tag
Protein LengthFull length (1-377 aa)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
MPN_160; MP671; VXpSPT7_orf377; Uncharacterized protein MG147 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_160
Target Protein Sequence
MLWTRALILELKTNKQSRLLWLLAIPLLISLTLLTYGLVLFSSSGRIDHGDHFHLRERFV LTTEELVTFVVASVVFALTVALFGLGCWKLLQGPKVDRTNIKLANSNPAPQAVVLQADCD HFQVGDHCVFSAEKQHFKQQFKQDFLGKSKFSFRNELYRFCLIGVLISLNLALSMVEIPG IVLPWGSSIQFRFFNTAILFIAIRFVGLLSTSLIAIITPWIHLLLHPVHTPISTVFYMGN DLVVLWIFYFFYYHIFKAEVKQTTTVVNNKEFSQLVNTHKTKVAKALALIPVNLICGFIE GLGFYVGYFLILGKFGSVGHKIFYDSQANRDLINSANVIYFLLTTTTIFSLKYLFELLFF YSVEKGILNISRHFGLY
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN160

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_160 and what organism does it originate from?

MPN_160 is an uncharacterized protein MG147 homolog from the bacterium Mycoplasma pneumoniae. It is a full-length protein consisting of 377 amino acids that remains functionally uncharacterized in the current scientific literature. As a protein from M. pneumoniae, it is associated with a pathogen that causes atypical pneumonia in humans, often referred to as "walking pneumonia" . The protein is classified as "uncharacterized" because its precise biological function has not been fully determined despite the genome of M. pneumoniae being sequenced.

What expression systems are available for producing recombinant MPN_160?

The recombinant form of MPN_160 is commonly expressed in E. coli expression systems, typically with an N-terminal or C-terminal histidine tag to facilitate purification. The methodology involves:

  • Cloning the MPN_160 gene into an appropriate expression vector

  • Transformation into a suitable E. coli strain (commonly BL21(DE3) or its derivatives)

  • Induction of expression using IPTG or auto-induction systems

  • Cell lysis and protein purification using nickel affinity chromatography

  • Further purification steps may include size exclusion chromatography or ion exchange chromatography

For researchers requiring high purity, it's advisable to incorporate additional chromatography steps beyond the initial nickel affinity purification to ensure removal of contaminants that might interfere with functional studies.

How can researchers verify the identity and integrity of purified recombinant MPN_160?

Identity and integrity verification of purified MPN_160 should include multiple complementary techniques:

Verification MethodPurposeExpected Results
SDS-PAGESize verificationSingle band at approximately 42 kDa (including His-tag)
Western BlotConfirmatory identificationPositive signal with anti-His antibody or specific antibody if available
Mass SpectrometryAccurate mass determinationMatches theoretical mass; identifies post-translational modifications
Circular DichroismSecondary structure assessmentIndicates proper protein folding
Dynamic Light ScatteringHomogeneity assessmentMonodisperse preparation without aggregates

Complete verification should include assessment of secondary structure to ensure the recombinant protein is properly folded, which is critical for functional studies .

What bioinformatic approaches can predict potential functions of MPN_160?

Given its status as an uncharacterized protein, comprehensive bioinformatic analysis is crucial and should follow this methodological framework:

  • Domain and motif identification: Utilize tools like InterProScan, SMART, HMMER, and NCBI CDART to identify conserved domains or motifs that might suggest function

  • Structure prediction: Apply homology-based structural modeling using Swiss-PDB and Phyre2 servers to infer potential functional roles based on structural similarities

  • String analysis: Identify potential protein-protein interactions to place MPN_160 within functional networks

  • Comparative genomics: Compare with homologous proteins in related organisms to identify conserved regions suggesting functional importance

  • Receiver operating characteristics (ROC) analysis: Evaluate the methodology with an expected accuracy of approximately 83% based on similar protein annotation studies

Researchers should validate bioinformatic predictions with experimental approaches, as computational predictions alone have limitations in accuracy for completely uncharacterized proteins.

What experimental methodologies are most effective for determining the cellular localization of MPN_160?

To determine MPN_160's cellular localization, researchers should employ a multi-method approach:

  • Computational prediction: Begin with tools like PSORT, SignalP, and TMHMM to predict subcellular localization, signal peptides, and transmembrane regions

  • Fluorescence microscopy: Express MPN_160 fused with GFP or other fluorescent tags in mycoplasma or model organisms to visualize localization patterns

  • Subcellular fractionation: Physically separate cellular components (membrane, cytoplasm, etc.) followed by Western blot detection

  • Immunogold electron microscopy: For highest resolution localization using specific antibodies against MPN_160 with gold-conjugated secondary antibodies

  • Surface biotinylation: To specifically determine if MPN_160 is exposed on the cell surface, which is particularly relevant for potential virulence factors

The integration of multiple methods offers higher confidence in localization determination, especially important for Mycoplasma proteins which may have atypical localization patterns due to the organism's minimal genome and unusual cell wall structure .

How should researchers design experiments to assess potential virulence-related functions of MPN_160?

Experimental design for virulence assessment requires rigorous approaches:

  • Hypothesis formulation: Based on preliminary bioinformatic predictions, formulate testable hypotheses about MPN_160's role in virulence

  • Variable identification:

    • Independent variables: MPN_160 presence/absence or mutation state

    • Dependent variables: Measurable virulence indicators

    • Control for extraneous variables: Use isogenic strains and standardized conditions

  • Genetic manipulation studies:

    • Gene knockout/knockdown to assess loss-of-function effects

    • Complementation studies to confirm phenotypic restoration

    • Point mutations in predicted functional domains

  • Host interaction assays:

    • Adherence to respiratory epithelial cells

    • Cytotoxicity measurements

    • Immune response activation

  • In vivo models:

    • Animal infection models with wild-type vs. MPN_160 mutants

    • Tissue colonization and persistence measurements

    • Inflammatory response quantification

  • Virulence prediction validation:

    • Confirm computational predictions from tools like VICMPred and VirulentPred with experimental results

This systematic approach allows researchers to establish cause-effect relationships between MPN_160 and virulence phenotypes while controlling for confounding variables.

What are the challenges in differentiating between direct and indirect effects when studying MPN_160 knockout phenotypes?

Differentiating between direct and indirect effects in MPN_160 knockout studies presents several methodological challenges:

  • Pleiotropy assessment: MPN_160 may participate in multiple pathways, causing phenotypic changes through different mechanisms

  • Compensation mechanisms: Other proteins may compensate for MPN_160 loss, masking direct effects

  • Temporal dynamics: Establishing causality requires time-course experiments to determine primary versus secondary effects

  • Experimental design approaches to address these challenges:

    • Use conditional knockouts or inducible expression systems

    • Perform comprehensive proteomic analysis to identify compensatory protein expression

    • Conduct epistasis studies by creating double mutants

    • Implement metabolic flux analysis to track biochemical pathway alterations

    • Employ RNA-seq to monitor global transcriptional responses

Researchers should implement multiple complementary approaches and carefully design controls to distinguish direct functional roles from secondary effects.

What methodologies are recommended for identifying interaction partners of MPN_160?

A comprehensive approach to identifying MPN_160 interaction partners should include:

  • In silico prediction:

    • String database analysis with confidence scores >1

    • Structural docking simulations using homology models

  • In vitro methods:

    • Pull-down assays using His-tagged MPN_160 as bait

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • In vivo techniques:

    • Bacterial two-hybrid systems adapted for mycoplasma

    • Co-immunoprecipitation from M. pneumoniae lysates

    • Proximity labeling techniques (BioID or APEX)

    • FRET or BRET to detect interactions in living cells

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of interacting proteins

    • MS/MS analysis to identify crosslinked peptides

    • Structural mapping of interaction interfaces

  • Validation strategies:

    • Reverse pull-downs with identified partners

    • Mutational analysis of interaction interfaces

    • Competition assays with peptides derived from interaction regions

These methodologies should be applied sequentially, starting with computational predictions to guide experimental design, followed by in vitro validation and finally in vivo confirmation of physiologically relevant interactions.

How can researchers distinguish between specific and non-specific interactions when studying MPN_160?

Distinguishing specific from non-specific interactions represents a significant challenge requiring methodological rigor:

  • Experimental controls:

    • Include unrelated His-tagged proteins as negative controls

    • Use varying salt concentrations to disrupt weak non-specific interactions

    • Implement competition assays with unlabeled protein

  • Quantitative approaches:

    • Determine binding affinities (Kd values) - specific interactions typically have Kd < 10 μM

    • Assess concentration-dependent binding with saturation curves

    • Compare binding stoichiometry with theoretical predictions

  • Washing stringency optimization:

    • Develop protocols with varying detergent concentrations

    • Establish washing steps that maintain specific interactions while eliminating background

  • Statistical validation:

    • Repeat experiments with biological replicates

    • Calculate significance of enrichment compared to controls

    • Apply appropriate statistical tests (t-test, ANOVA) to interaction data

Researchers should report both positive and negative results, including proteins that show non-specific binding, to establish robust protocols for the scientific community.

What are the most appropriate methods for determining the structure of MPN_160?

The structural characterization of MPN_160 should follow a strategic approach based on protein properties:

For uncharacterized proteins like MPN_160, an integrated structural biology approach combining multiple techniques often yields the most comprehensive insights into structure-function relationships.

How can structural information about MPN_160 inform functional hypotheses?

Structural data can provide critical insights into MPN_160 function through several analytical approaches:

  • Structural motif identification:

    • Compare solved or predicted structures to databases of known structural motifs

    • Identify catalytic triads or binding pockets suggestive of enzymatic activity

  • Electrostatic surface mapping:

    • Calculate surface charge distribution to identify potential binding regions

    • Predict DNA/RNA binding regions from positively charged patches

  • Structural alignment with characterized proteins:

    • Perform DALI or VAST searches to find structural homologs

    • Infer function from structural similarity even in absence of sequence homology

  • Ligand binding site prediction:

    • Use computational tools like FTSite to identify potential binding pockets

    • Perform in silico docking with potential ligands

  • Experimental validation of structural predictions:

    • Site-directed mutagenesis of predicted functional residues

    • Binding assays with predicted ligands

    • Activity assays based on structural similarity to known enzymes

Structural information is particularly valuable for uncharacterized proteins like MPN_160, as structure tends to be more conserved than sequence, potentially revealing functional relationships not detectable through sequence analysis alone.

How should researchers approach comparative genomic analysis of MPN_160 across Mycoplasma species?

A systematic comparative genomics approach for MPN_160 should include:

  • Homolog identification:

    • BLAST searches against Mycoplasma genomes

    • Phylogenetic analysis to distinguish orthologs from paralogs

    • Synteny analysis to identify conserved genomic contexts

  • Sequence conservation analysis:

    • Multiple sequence alignment of identified homologs

    • Conservation scoring to identify functionally important residues

    • Selection pressure analysis (dN/dS ratios) to identify residues under evolutionary constraint

  • Correlation with pathogenicity:

    • Compare presence/absence patterns across pathogenic and non-pathogenic species

    • Analyze sequence variations specific to highly virulent strains

    • Examine association with other virulence factors

  • Structural comparison:

    • Model structures of homologs to identify conserved structural features

    • Compare predicted binding sites across species

  • Experimental validation:

    • Complementation studies across species

    • Heterologous expression to test functional conservation

    • Domain swapping experiments between homologs

This approach helps distinguish species-specific adaptations from core conserved functions, providing crucial context for understanding MPN_160's role within the Mycoplasma genus.

What methodological considerations are important when attempting to identify MPN_160 function through heterologous expression in model organisms?

Heterologous expression studies require careful methodological considerations:

  • Expression system selection:

    • Consider codon usage differences (Mycoplasma uses UGA as tryptophan rather than stop codon)

    • Evaluate post-translational modification requirements

    • Assess potential toxicity in host systems

  • Expression validation:

    • Confirm proper folding through activity assays or structural analysis

    • Verify subcellular localization matches native patterns

    • Check for formation of inclusion bodies or aggregates

  • Functional complementation design:

    • Identify potential orthologous genes in model organisms

    • Create clean deletion strains of the ortholog

    • Establish quantifiable phenotypes for complementation assessment

  • Controls and variables:

    • Include empty vector controls

    • Test expression under different promoters and induction conditions

    • Consider fusion tags that minimize functional interference

  • Interpreting negative results:

    • Distinguish between true lack of function and technical limitations

    • Test for protein-protein interaction dependencies

    • Consider organism-specific cofactor requirements

Researchers should recognize that failure to demonstrate function in heterologous systems may reflect missing interaction partners or cellular contexts rather than lack of function.

What approaches are recommended for studying the regulation of MPN_160 expression?

A comprehensive investigation of MPN_160 regulation should include:

  • Transcriptional regulation analysis:

    • Promoter identification and characterization

    • Transcription start site mapping using 5' RACE

    • Reporter gene assays with promoter constructs

    • ChIP-seq to identify transcription factor binding

  • Expression profiling:

    • qRT-PCR analysis under various conditions

    • RNA-seq to place MPN_160 within co-expression networks

    • Identification of operonic structure and polycistronic transcripts

  • Post-transcriptional regulation:

    • mRNA stability assessment

    • Identification of regulatory small RNAs

    • Analysis of 5' and 3' UTR elements affecting translation

  • Environmental response characterization:

    • Expression analysis under different stress conditions

    • Host cell contact response studies

    • Nutrient limitation experiments

  • Validation approaches:

    • Mutational analysis of predicted regulatory elements

    • Direct binding assays for identified regulators

    • In vivo confirmation using Mycoplasma genetic tools

Given Mycoplasma's minimal genome, regulation may be less complex than in other bacteria, but integrated approaches remain essential for comprehensive understanding.

How can researchers design experiments to determine if MPN_160 is essential for Mycoplasma pneumoniae viability?

Determining essentiality requires rigorous experimental design:

  • Genetic approaches:

    • Attempted construction of clean deletions or insertions

    • Transposon mutagenesis coupled with next-generation sequencing

    • CRISPR interference for conditional knockdown

  • Conditional expression systems:

    • Inducible promoter replacement at native locus

    • Depletion studies with regulated expression

    • Monitoring growth cessation following expression shutdown

  • Complementation strategies:

    • Merodiploid strains with second copy at ectopic location

    • Plasmid-based expression systems (if available)

    • Heterologous complementation with homologs

  • Essential gene validation criteria:

    • Inability to obtain null mutants

    • Growth dependence on inducer presence

    • Lethality following depletion

    • Rescue by complementation

  • Controls and variables:

    • Parallel targeting of known essential and non-essential genes

    • Multiple independent attempts at disruption

    • Testing essentiality across different growth conditions

Researchers should consider that essentiality may be condition-dependent, necessitating testing under various environmental conditions to fully characterize MPN_160's importance for Mycoplasma pneumoniae viability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.