Recombinant Mycoplasma pneumoniae Uncharacterized protein MG149.1 homolog (MPN_163)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycoplasma pneumoniae Uncharacterized Protein MGHomolog (MPN_163)

Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG149.1 homolog (MPN_163) is a protein that is considered an uncharacterized protein, and it is found in Mycoplasma pneumoniae . M. pneumoniae is a bacterial species known to cause respiratory infections in humans, including atypical pneumonia . Specifically, the recombinant form of this protein is produced using genetic engineering techniques, often in E. coli or other expression systems, for research purposes .

Characteristics

CharacteristicDescription
Full NameRecombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg149.1 Homolog (Mpn_163) Protein, His-Tagged
SourceMycoplasma pneumoniae
HostE. coli, Yeast, Baculovirus, or Mammalian Cell
TagHis-Tagged (N-terminal 10xHis tag and C-terminal Myc tag fusion)
Protein LengthFull Length (1-136)
Molecular Weight15.4 kDa
Purity>90%
FormLiquid containing glycerol
StorageStore at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended .
AA SequenceMACKRQTSLEKDKELVSSIVTAKSMIDRFFWSILSFLLTNLVFLFVAFLILIIYLISEITQQFAFAFIATIVFIIFYNILFLSYLLTMYIKGLKQIEQKSRYLLLVLDVKADELLPFSFLGSLRKSHmLEEmLLEQ
Gene NamesMPN_163, MP668, VXpSPT7_orf112
Expression Region1-136

Function and Role

The specific function of MPN_163 is currently not well-defined, classifying it as an uncharacterized protein . Proteins like MPN_163, may contribute to the bacterium's survival, virulence, or interaction with its host . Further research is needed to elucidate its precise biological role within M. pneumoniae .

Research Applications

Recombinant MPN_163 is used in various research applications :

  • ELISA assays: It can be utilized as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify antibodies against M. pneumoniae .

  • Protein interaction studies: Recombinant MPN_163 can be employed to identify interacting proteins and molecules, offering insights into its potential function and involvement in cellular pathways .

  • Structural studies: It can be used for structural analysis to understand its three-dimensional structure, which may provide clues about its function .

  • Antibody production: Recombinant MPN_163 can be used to generate specific antibodies for research and diagnostic purposes .

Related proteins in Mycoplasma pneumoniae

There are other uncharacterized proteins in Mycoplasma pneumoniae that have been researched, such as MG211 homolog (P75481), MG218.1 homolog (MPN_311), MG294 homolog (MPN_421), and lipoprotein MG440 homolog 2 (MPN_643) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_163; MP668; VXpSPT7_orf112; Uncharacterized protein MG149.1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_163
Target Protein Sequence
MACKRQTSLEKDKELVSSIVTAKSMIDRFFWSILSFLLTNLVFLFVAFLILIIYLISEIT QQFAFAFIATIVFIIFYNILFLSYLLTMYIKGLKQIEQKSRYLLLVLDVKADELLPFSFL GSLRKSHMLEEMLLEQ
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN163

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant MPN_163 production?

Recombinant MPN_163 can be successfully expressed in several heterologous systems, with E. coli being the most commonly used for research applications . The expression protocol typically involves:

  • Vector selection: pET-based vectors with N-terminal His-tag are widely used

  • Expression conditions:

    • Induction with 0.5-1.0 mM IPTG

    • Growth at lower temperatures (16-25°C) to enhance solubility

    • Extended expression time (16-24 hours) for optimal yield

What storage conditions maximize MPN_163 stability and functionality?

For optimal stability, recombinant MPN_163 should be stored as follows:

Storage TypeRecommended ConditionsDuration
Long-term-80°C in buffer containing 20-50% glycerol>6 months
Medium-term-20°C in buffer containing 20% glycerol1-6 months
Working stock4°C in appropriate buffer≤1 week

The protein should be maintained in a Tris/PBS-based buffer at pH 8.0 with 6% trehalose . Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided; instead, prepare small working aliquots for regular use . The addition of protease inhibitors is recommended if proteolytic degradation is observed during storage.

How does MPN_163 relate to other Mycoplasma proteins in evolutionary context?

MPN_163 represents one of the many uncharacterized proteins retained in the minimal genome of Mycoplasma pneumoniae, which has undergone reductive evolution . Comparative genomic analyses reveal that:

  • MPN_163 is homologous to MG149.1 in related Mycoplasma species

  • The protein shows limited sequence conservation across Mycoplasma species

  • Phylogenetic analysis suggests it may be part of the core genome retained during the evolutionary minimization process

This evolutionary conservation suggests biological significance despite the lack of characterized function. Researchers studying minimal genomes often focus on such proteins to understand the fundamental requirements for cellular life .

What experimental design approaches are most effective for elucidating MPN_163 function?

A comprehensive experimental design to characterize MPN_163 function should incorporate multiple complementary approaches:

A. Genetic Manipulation Studies:

  • Generate MPN_163 knockout or knockdown mutants in M. pneumoniae

  • Compare phenotypic differences between wildtype and mutant strains

  • Construct complementation strains to confirm phenotype specificity

B. Protein-Protein Interaction Studies:

  • Conduct pull-down assays using His-tagged MPN_163

  • Perform bacterial two-hybrid screening

  • Use crosslinking mass spectrometry to identify interaction partners

  • Validate interactions through co-immunoprecipitation

C. Structural Analysis:

  • Determine protein structure through X-ray crystallography or cryo-EM

  • Identify potential binding domains through in silico modeling

  • Conduct mutagenesis studies targeting predicted functional domains

When designing these experiments, incorporate blocking strategies to group similar experimental units, thereby reducing variability and increasing statistical power . For example, when comparing wildtype and mutant strains, ensure that all experimental conditions (growth media, temperature, etc.) are identical except for the genetic manipulation variable.

A parametric design approach may be useful when studying factors that affect MPN_163 function across a continuous range of values (e.g., temperature, pH, or substrate concentration) . This allows for more comprehensive understanding of the protein's behavior under various conditions.

How might MPN_163 contribute to Mycoplasma pneumoniae pathogenicity?

Although the exact function of MPN_163 remains uncharacterized, several lines of evidence suggest potential roles in M. pneumoniae pathogenicity:

Membrane Association: The hydrophobic regions in MPN_163 suggest it may be membrane-associated, potentially involved in:

  • Host cell adhesion

  • Membrane integrity maintenance

  • Transport of molecules across the membrane

  • Evasion of host immune responses

Investigation approaches should include:

  • Adhesion assays: Compare attachment efficiency of wildtype and MPN_163-deficient strains to human respiratory epithelial cells

  • Cytotoxicity studies: Assess hydrogen peroxide release and cytotoxicity similar to methods used for GlpQ studies

  • Immune response analysis: Evaluate host inflammatory responses to recombinant MPN_163 in cell culture and animal models

  • Transcriptomic analysis: Compare gene expression profiles between wildtype and MPN_163-deficient strains during infection

Additionally, considering the phosphoproteome studies in M. pneumoniae, investigating potential phosphorylation of MPN_163 would be valuable, as phosphorylation has been shown to affect virulence factors in this organism .

What techniques can resolve contradictory data when characterizing MPN_163?

When facing contradictory data in MPN_163 characterization studies, implement the following systematic approach:

A. Experimental Validation and Reproducibility:

  • Repeat experiments with increased biological and technical replicates

  • Vary experimental conditions systematically to identify context-dependent effects

  • Benchmark against positive and negative controls with known outcomes

  • Exchange materials with collaborating laboratories for independent verification

B. Statistical Analysis:

  • Apply R's data.table package for efficient data manipulation and analysis

  • Implement robust statistical methods less sensitive to outliers

  • Use Bayesian approaches to incorporate prior knowledge into analysis

  • Perform meta-analysis if multiple datasets exist across different studies

C. Multi-Method Triangulation:
When different experimental approaches produce contradictory results:

  • Use orthogonal techniques to measure the same parameter

  • Evaluate each method's assumptions and limitations

  • Consider whether contradictions reflect biological complexity rather than experimental error

  • Develop integrated models that accommodate apparently contradictory data

D. Biological Context Consideration:

  • Evaluate whether contradictions arise from different experimental contexts (in vitro vs. in vivo)

  • Assess protein behavior under different physiological conditions

  • Consider potential post-translational modifications affecting protein function

This structured approach ensures that contradictions become opportunities for deeper understanding rather than obstacles to research progress.

How can recombinant MPN_163 be utilized in synthetic biology applications?

Recombinant MPN_163 offers several applications in synthetic biology research:

A. Minimal Genome Construction:
As part of efforts to create synthetic minimal genomes, MPN_163 can be incorporated into:

  • Synthetic Mycoplasma genomes using MoClo assembly systems

  • Chassis organisms with streamlined genomes

  • Test systems to determine essentiality of genes in minimal organisms

B. Pathway Reconstruction:

  • Integrate MPN_163 into reconstituted M. pneumoniae pathways to understand its functional context

  • Express in heterologous systems alongside other Mycoplasma proteins to recreate functional modules

  • Use as a component in minimal membrane systems to study transport or structural functions

C. Biosensor Development:
If MPN_163 interacts with specific molecules or conditions, it could be engineered into:

  • Whole-cell biosensors for environmental monitoring

  • Diagnostic tools for detecting specific conditions

  • Reporter systems for studying cellular processes

D. Methodological Considerations:
When designing these applications:

  • Optimize codon usage for the host organism (e.g., E. coli codon optimization has been successful)

  • Consider fusion partners that enhance stability or facilitate detection

  • Implement inducible expression systems to control protein production

  • Design experimental controls to validate functionality in synthetic contexts

The standardized MoClo assembly compatibility of synthesized M. pneumoniae genes facilitates their integration into various synthetic biology platforms .

What is the potential role of MPN_163 in developing vaccines against Mycoplasma pneumoniae?

MPN_163 could serve as a component in vaccine development strategies against M. pneumoniae, similar to approaches using other Mycoplasma proteins:

A. Antigen Potential Assessment:

  • Evaluate immunogenicity of purified recombinant MPN_163 in animal models

  • Identify epitope regions through computational prediction and experimental validation

  • Assess cross-reactivity with human proteins to avoid autoimmune complications

  • Compare antibody responses between naturally infected and immunized subjects

B. Vaccine Platform Options:

  • Recombinant vector vaccines: Similar to the influenza virus vector approach used for P1 and P30 antigens

  • Subunit vaccines: Purified MPN_163 or immunogenic fragments

  • DNA vaccines: Encoding MPN_163 for in vivo expression

  • Multi-antigen formulations: Combining MPN_163 with known immunogenic proteins like P1 and P30

C. Methodological Approaches:

  • Express recombinant MPN_163 with proper folding and post-translational modifications

  • Conduct structural studies to identify surface-exposed epitopes

  • Design chimeric constructs incorporating MPN_163 epitopes with immunogenic carriers

  • Evaluate vaccine formulations in appropriate animal models before clinical testing

D. Challenges and Considerations:

  • The uncharacterized nature of MPN_163 necessitates thorough safety evaluation

  • Potential membrane association may require special formulation strategies

  • Adjuvant selection will be critical for optimizing immune responses

  • Efficacy assessment requires standardized infection models and correlates of protection

This approach parallels successful strategies with other Mycoplasma pneumoniae antigens, where recombinant proteins have shown promise in pre-clinical vaccine development .

How can phosphoproteomics approaches enhance understanding of MPN_163 function?

Phosphoproteomics offers powerful tools for elucidating MPN_163 function in the context of M. pneumoniae cellular processes:

A. Identification of Phosphorylation Sites:

  • Use two-dimensional gel electrophoresis coupled with mass spectrometry to detect phosphorylated forms of MPN_163

  • Apply titanium dioxide enrichment techniques to concentrate phosphopeptides

  • Implement parallel reaction monitoring for targeted detection of specific phosphorylation events

  • Compare phosphorylation patterns across different growth conditions and stress responses

B. Kinase-Substrate Relationship Investigation:

  • Examine interactions with known M. pneumoniae kinases (HPrK and PrkC)

  • Perform in vitro phosphorylation assays with purified kinases

  • Construct kinase-deficient mutants to assess effects on MPN_163 phosphorylation

  • Analyze phosphorylation dynamics in response to environmental stimuli

C. Functional Impact Assessment:

  • Generate phosphomimetic and phosphodeficient MPN_163 mutants

  • Compare biochemical properties and interaction profiles of phosphorylated vs. non-phosphorylated forms

  • Evaluate cellular localization changes upon phosphorylation

  • Assess impact on virulence-related phenotypes like adhesion or cytotoxicity

D. Data Analysis and Integration:

  • Apply computational tools to predict functional consequences of phosphorylation

  • Integrate phosphoproteomics data with transcriptomics and proteomics datasets

  • Model signaling networks incorporating MPN_163 phosphorylation

  • Compare with phosphorylation events in homologous proteins from related species

The phosphoproteome studies in M. pneumoniae have revealed 63 phosphorylated proteins involved in key cellular processes , suggesting that phosphorylation might regulate MPN_163 function in ways relevant to bacterial adaptation or virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.