Recombinant Mycoplasma pneumoniae Uncharacterized protein MG181 homolog (MPN_195)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Commercial vendors (e.g., Creative Biomart, MyBioSource) produce this protein for research use. Key production details include:

  • Expression System: Optimized codon usage in E. coli for high yield .

  • Purification: Affinity chromatography followed by lyophilization .

  • Applications:

    • Antigenic studies for antibody development

    • Structural analysis of uncharacterized Mycoplasma proteins

    • Functional genomics to elucidate hypothetical protein roles

Genomic and Functional Context

Association with Mycoplasma Pathogenesis

  • Antigenic Variation: While MPN_195 itself is not directly linked to antigenic variation, studies on related proteins (e.g., RecA homolog MPN490) suggest that Mycoplasma surface protein diversity arises from recombination between repetitive genomic elements (RepMPs) .

  • Hypothetical Roles:

    • Potential involvement in nutrient uptake (inferred from MG181 homology)

    • Structural or regulatory functions in bacterial adhesion complexes

Research Gaps and Future Directions

  • Functional Characterization: No experimental data currently link MPN_195 to specific metabolic or pathogenic pathways.

  • Comparative Genomics: The gene is conserved across Mycoplasma strains, suggesting evolutionary importance .

  • Commercial Use: Available recombinant forms enable structural studies (e.g., crystallography) to resolve its 3D architecture .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life can be influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing your preferred tag.
Synonyms
MPN_195; GT9_orf434; MP636; Uncharacterized protein MG181 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_195
Target Protein Sequence
MDSFFINGYVPRDTFIHRLHPTTKLLIFLLFVILVFVPIGFVFQSVIFVFATVIFFVAKL PGRFYLSSIKSISLLFLLLLFVNWFTFRDPGFYITADQVNTVKPHFNGNNFNFWNISLFN YQDNVFSQVFNFNRANMTELNKINFFFKETANANAYTKVTGIDKLAEMLASKNLFKFNGS TNGIDKNKILGAFLDHKIAVYLGRSWGGDFSGFVIDVSVSDKTSTFTIKPFLANSNYVLT LRAIILAFYVTQKILIMIILATVLTSTSSSVELAYGIERLLWPLKLLRVPVNVFAMTIAI AIRFVPSLLLESQRILNAQASRGLDFKNGNFFVKMRSLSSLVVPMISIAFRNAGELASAM EARGYDPTKKRTTYRKFKIDWVDATALILTALYFVVIIFLTVKGAVFLDLGTPEWLLTGK IKEQVERSLSVKSA
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN195

Protein Families
CbiQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does MPN_195 relate to the minimal genome concept in Mycoplasma pneumoniae?

MPN_195 exists within one of the smallest self-replicating organisms. M. pneumoniae possesses a highly reduced genome of approximately 816,394 bp containing only 689 open reading frames (ORFs) . This minimal genome results from evolutionary genome reduction from a Gram-positive ancestor, retaining only essential functions for its parasitic lifestyle .

To investigate MPN_195's role in this minimal genome context, researchers should consider:

  • Comparative genomics approaches across multiple Mycoplasma species to identify conserved domains

  • Functional genomics studies using targeted gene disruption or silencing methods

  • Integration of transcriptomic and proteomic data to determine expression patterns under different growth conditions

  • Analysis of protein interaction networks to identify potential functional partners

The retention of MPN_195 in this highly reduced genome suggests essential functionality, making it an important target for understanding the minimal genetic requirements for cellular life.

What bioinformatic approaches are recommended for initial characterization of MPN_195?

For uncharacterized proteins like MPN_195, a systematic bioinformatic analysis should precede experimental work:

  • Sequence homology analysis: Compare against characterized proteins using BLAST, HHpred, and PFAM to identify conserved domains and potential functions.

  • Structural prediction:

    • Secondary structure prediction using JPred4 or PSIPRED

    • Tertiary structure prediction using AlphaFold2 or RoseTTAFold

    • Transmembrane topology prediction using TMHMM or Phobius (particularly important given the hydrophobic regions)

  • Functional prediction:

    • GO term enrichment analysis of homologous proteins

    • Predict subcellular localization using tools like PSORTb or SignalP

    • Identify potential protein-protein interaction partners from genomic context

  • Comparative genomics:

    • Analyze presence/absence patterns across Mycoplasma strains

    • Examine synteny to identify conserved genomic neighborhoods

These computational approaches provide critical hypotheses to guide experimental design, particularly important given M. pneumoniae's challenging culture requirements and genetic manipulation limitations .

What are the optimal conditions for recombinant expression of MPN_195?

Based on available data, recombinant MPN_195 has been successfully expressed in E. coli with an N-terminal His-tag . The optimal expression system requires careful consideration:

Expression system selection:

  • E. coli BL21(DE3) derivatives are commonly used for initial expression trials

  • Consider specialized strains like Rosetta for rare codon optimization

  • For membrane proteins, C41(DE3) or C43(DE3) strains may improve yields

Expression optimization parameters:

  • Induction temperature: 16-18°C typically yields higher amounts of soluble protein

  • IPTG concentration: 0.1-0.5 mM range, with lower concentrations favoring proper folding

  • Expression time: Extended expression (16-24 hours) at lower temperatures

  • Media: Enriched media (e.g., Terrific Broth) to support higher cell densities

Solubilization considerations:

  • Given the hydrophobic nature of MPN_195, the addition of mild detergents like n-dodecyl β-D-maltoside (DDM) at 0.5-1% may improve solubility

  • Co-expression with chaperones (GroEL/GroES system) may enhance proper folding

For challenging proteins like MPN_195, parallel expression trials testing multiple conditions simultaneously will identify optimal parameters for maximum yield of properly folded protein.

What purification strategy is recommended for obtaining high-purity MPN_195 for structural studies?

A multi-step purification strategy is recommended for MPN_195:

Initial capture:

  • Immobilized metal affinity chromatography (IMAC) using His-tag affinity

  • Use Ni-NTA or TALON resin with imidazole gradient elution

  • Buffer composition: Tris/PBS-based buffer at pH 8.0

Intermediate purification:

  • Ion exchange chromatography based on the protein's theoretical pI

  • Consider detergent inclusion for maintaining solubility

Polishing step:

  • Size exclusion chromatography to achieve >95% purity

  • Buffer optimization: Tris/PBS-based buffer with 6% trehalose as indicated in available protocols

Quality control checks:

  • SDS-PAGE to confirm >90% purity

  • Western blot to verify identity

  • Dynamic light scattering to assess monodispersity

  • Mass spectrometry to confirm intact mass and post-translational modifications

For crystallography studies, additional considerations include screening for stability-enhancing additives and testing limited proteolysis to identify stable domains if the full-length protein proves challenging.

How should reconstitution of lyophilized MPN_195 be performed to maintain structural integrity?

Proper reconstitution of lyophilized MPN_195 is critical for downstream applications:

  • Pre-reconstitution preparation: Briefly centrifuge the vial to ensure the lyophilized material is at the bottom .

  • Reconstitution procedure:

    • Add deionized sterile water to achieve 0.1-1.0 mg/mL concentration

    • Mix by gentle inversion rather than vortexing to prevent aggregation

    • Allow complete dissolution at room temperature for 15-30 minutes

  • Storage preparation:

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Aliquot into single-use volumes to avoid freeze-thaw cycles

    • Flash freeze in liquid nitrogen and store at -20°C/-80°C

  • Quality validation:

    • Check for visible precipitation

    • Verify activity/folding using applicable functional assays

    • Confirm secondary structure using circular dichroism if available

The addition of 6% trehalose in the storage buffer appears to enhance stability based on available protocols . Researchers should be aware that repeated freeze-thaw cycles are not recommended as they significantly reduce protein activity and integrity .

What computational approaches can predict the structure-function relationship of MPN_195?

For an uncharacterized protein like MPN_195, computational approaches provide valuable initial insights:

Structure prediction pipeline:

  • AlphaFold2 or RoseTTAFold for ab initio tertiary structure prediction

  • Molecular dynamics simulations to predict flexibility and potential conformational changes

  • Docking studies with potential ligands identified through genomic context

Function prediction methods:

  • Structure-based function prediction using tools like ProFunc or COFACTOR

  • Identification of potential binding pockets using CASTp or SiteMap

  • Comparison with structural neighbors using DALI or TM-align

  • Electrostatic surface analysis for potential interaction interfaces

Protein-protein interaction prediction:

  • Sequence-based methods (PIPE, STRING)

  • Structure-based protein-protein docking simulations

  • Coevolution analysis to identify potential interaction partners

These computational predictions should guide experimental design by generating testable hypotheses about protein function. For transmembrane proteins like MPN_195, special attention should be paid to predicting orientation within the membrane and identifying exposed regions that might interact with host factors.

How can researchers investigate the potential role of MPN_195 in Mycoplasma pneumoniae attachment to host cells?

Given M. pneumoniae's dependence on close host contact for nutrient acquisition and the hydrophobic nature of MPN_195, investigating its potential role in host attachment requires multifaceted approaches:

Cell adhesion assays:

  • Generate fluorescently-labeled recombinant MPN_195 to directly visualize binding to host respiratory epithelial cells

  • Develop blocking antibodies against MPN_195 to test inhibition of M. pneumoniae attachment

  • Compare attachment efficiency of wild-type versus MPN_195 knockout/knockdown strains

Localization studies:

  • Immunogold electron microscopy to determine if MPN_195 localizes to the attachment organelle

  • Fluorescence microscopy with domain-specific antibodies to map protein orientation

  • Subcellular fractionation followed by Western blotting to confirm membrane association

Interaction studies:

  • Pull-down assays with solubilized human respiratory epithelial cell surface proteins

  • Yeast two-hybrid or bacterial two-hybrid screening against human protein libraries

  • Co-immunoprecipitation with known adhesion proteins (P1, P40, P90)

When designing these experiments, it's important to consider that MPN_195 may function independently or cooperatively with the known attachment proteins. Comparative studies across different M. pneumoniae strains (subtype 1 and 2) may reveal strain-specific functions.

What are the appropriate experimental controls when studying MPN_195 function in vitro?

Robust experimental controls are essential for functional studies of uncharacterized proteins:

Negative controls:

  • Empty vector expression products processed identically to MPN_195

  • Irrelevant His-tagged protein of similar size and properties

  • Heat-denatured MPN_195 to differentiate between specific and non-specific effects

  • Competitive inhibition with excess unlabeled protein in binding assays

Positive controls:

  • Known M. pneumoniae attachment proteins (P1, P40, P90) in adhesion assays

  • Well-characterized membrane proteins in solubilization/reconstitution experiments

  • Established M. pneumoniae strains with known attachment phenotypes

Technical validation controls:

  • Multiple antibody clones targeting different epitopes to confirm specificity

  • Multiple cell lines to ensure observed effects aren't cell-type specific

  • Different expression systems to rule out expression artifacts

  • Dose-response relationships to establish biological relevance

Genetic validation:

  • Complementation studies with wild-type MPN_195 in knockout strains

  • Site-directed mutagenesis of predicted functional residues

  • Domain deletion analyses to map functional regions

These comprehensive controls help distinguish true biological functions from experimental artifacts, particularly important when working with uncharacterized proteins where expected outcomes are uncertain.

How might MPN_195 contribute to M. pneumoniae pathogenesis?

Understanding MPN_195's potential role in pathogenesis requires consideration of M. pneumoniae's infection cycle:

Potential mechanisms in pathogenesis:

  • Host attachment: The hydrophobic regions in MPN_195 suggest possible involvement in attachment to host respiratory epithelium, potentially working alongside the established attachment proteins (P1, P40, P90) .

  • Nutrient acquisition: M. pneumoniae relies on host cells for essential nutrients due to its limited metabolic capacity . MPN_195 might function in nutrient transport or scavenging.

  • Immune evasion: Given the antigenic variation observed in M. pneumoniae attachment proteins , MPN_195 could potentially contribute to evading host immunity through:

    • Molecular mimicry of host proteins

    • Sequestration of host immune factors

    • Modification of surface-exposed epitopes

  • Host cell manipulation: MPN_195 might interact with host signaling pathways to create a favorable environment for bacterial survival.

Experimental approaches to test pathogenesis roles:

  • Infection models using wild-type vs. MPN_195-deficient strains

  • Transcriptomic analysis during different infection stages

  • Immunological studies examining host response to MPN_195

  • Comparative virulence studies across M. pneumoniae strains with MPN_195 variations

The retention of MPN_195 in the minimal genome of M. pneumoniae strongly suggests it provides essential functionality for the organism's parasitic lifestyle .

What techniques can investigate potential genetic variation in MPN_195 across M. pneumoniae strains?

Genetic variation analysis is particularly relevant for M. pneumoniae, which exhibits antigenic variation as a potential immune evasion strategy :

Sequence-based approaches:

  • Whole-genome sequencing of multiple clinical isolates:

    • Short-read sequencing (Illumina) for SNP identification

    • Long-read sequencing (PacBio, Nanopore) for structural variant detection

    • Assembly and comparative analysis to reference strains

  • Targeted amplicon sequencing of MPN_195:

    • Design primers for conserved flanking regions

    • Deep sequencing to identify minor variants

    • Analysis of sequence diversity metrics (π, θ, Tajima's D)

  • RepMP element analysis:

    • Examine MPN_195 for RepMP elements similar to those in MPN141/MPN142

    • Assess recombination potential with other genomic regions

Functional validation approaches:

  • Expression of variant MPN_195 proteins to assess functional differences

  • Antibody cross-reactivity testing against variant proteins

  • Host interaction studies comparing variant proteins

Population-level analyses:

  • Geographical distribution of variants

  • Temporal analysis during epidemic cycles

  • Association of variants with clinical severity

When investigating MPN_195 variants, researchers should consider the cyclic epidemic pattern of M. pneumoniae infections (every 3-7 years) and potential selective pressures from host immunity driving genetic diversity.

How should researchers approach studying potential interactions between MPN_195 and other M. pneumoniae proteins?

Understanding protein-protein interactions is crucial for elucidating MPN_195 function within the context of M. pneumoniae's simplified proteome:

Computational prediction approaches:

  • Genomic context analysis (gene neighborhood, gene fusion, co-occurrence)

  • Co-expression pattern analysis from existing transcriptomic data

  • Protein-protein interaction prediction algorithms

In vitro interaction studies:

  • Pull-down assays with His-tagged MPN_195 :

    • Using M. pneumoniae lysates to identify natural binding partners

    • Targeted pull-downs with suspected interaction partners

  • Surface Plasmon Resonance (SPR) for interaction kinetics:

    • Immobilize purified MPN_195 on sensor chip

    • Flow potential interaction partners at varying concentrations

    • Determine kon, koff, and KD values

  • Crosslinking mass spectrometry:

    • Use membrane-permeable crosslinkers to capture in vivo interactions

    • Identify interaction sites through MS/MS analysis

In vivo validation approaches:

  • Bacterial two-hybrid system:

    • Specially adapted for membrane proteins if needed

    • Screen against M. pneumoniae genomic library

  • Fluorescence microscopy:

    • Co-localization studies with fluorescently tagged proteins

    • FRET analysis for direct interaction confirmation

  • Genetic approaches:

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor screens to identify functional relationships

Given M. pneumoniae's minimal genome (689 ORFs) , a comprehensive interactome approach is feasible and would provide valuable insights into MPN_195's functional network.

How can structural studies of MPN_195 contribute to understanding minimal genome requirements?

Structural characterization of MPN_195 can provide unique insights into minimal genome biology:

Structural biology approaches:

  • X-ray crystallography:

    • Challenges include obtaining diffraction-quality crystals for a membrane protein

    • Consider lipidic cubic phase crystallization

    • Use of truncated constructs or fusion proteins to facilitate crystallization

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure

    • Subtomogram averaging if MPN_195 exists in oligomeric assemblies

    • In situ structural studies within M. pneumoniae cells

  • NMR spectroscopy:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Dynamics studies to understand conformational flexibility

Structural insights relevant to minimal genomes:

  • Investigation of multifunctionality through identification of multiple binding sites

  • Structural comparisons with homologs from larger genome organisms

  • Identification of simplified structural motifs that maintain essential functions

  • Understanding structural adaptations enabling function with minimal sequence length

The structure of MPN_195 might reveal how M. pneumoniae achieves necessary functions with a limited proteome, potentially demonstrating evolutionary adaptations toward functional efficiency with minimal genetic material .

What approaches can elucidate the potential role of MPN_195 in M. pneumoniae metabolism?

Given M. pneumoniae's limited metabolic capacity and dependence on host resources , understanding MPN_195's potential metabolic functions is crucial:

Metabolic function investigation approaches:

  • Metabolite binding assays:

    • Thermal shift assays with potential metabolites

    • Isothermal titration calorimetry for binding energetics

    • Metabolite array screening for unknown ligands

  • Transport assays:

    • Reconstitution into liposomes for transport studies

    • Radioactive or fluorescently labeled substrate tracking

    • Patch-clamp electrophysiology if ion channel activity is suspected

  • Metabolomic studies:

    • Comparative metabolomics between wild-type and MPN_195-deficient strains

    • Isotope labeling to track metabolite flux

    • Ex vivo metabolic profiling in host-pathogen interface models

  • Integration with systems biology:

    • Constraint-based modeling of M. pneumoniae metabolism

    • Flux balance analysis incorporating MPN_195 functions

    • Multi-omics data integration for contextual understanding

When designing these experiments, researchers should consider that in minimal genome organisms, proteins often exhibit moonlighting functions that may not be predicted from sequence alone. The experimental design should therefore capture both expected and unexpected metabolic roles.

How can researchers develop inhibitors targeting MPN_195 for potential therapeutic applications?

Development of MPN_195 inhibitors could provide novel therapeutic strategies against M. pneumoniae infections:

Target validation approaches:

  • Genetic studies confirming essentiality for bacterial viability or virulence

  • Structural analysis identifying druggable pockets

  • In vitro assays demonstrating biochemical activity amenable to inhibition

Inhibitor discovery strategy:

  • Structure-based design pipeline:

    • Virtual screening against predicted binding sites

    • Fragment-based lead discovery

    • Molecular dynamics simulations to identify transient pockets

  • High-throughput screening approaches:

    • Biochemical activity assays adapted to 384/1536-well format

    • Thermal shift assays to identify stabilizing compounds

    • Whole-cell phenotypic screens with target validation

  • Rational design considerations:

    • Focus on bacterial selectivity over human homologs

    • Consider membrane permeability for intracellular targets

    • Develop structure-activity relationships through medicinal chemistry

Lead optimization process:

  • Iterative structure-based optimization cycles

  • ADME-Tox profiling for promising candidates

  • Efficacy testing in cellular and animal infection models

When developing inhibitors, researchers should consider the potential for MPN_195 to develop resistance mutations, designing inhibitors with high genetic barriers to resistance or considering combination approaches targeting multiple essential proteins simultaneously.

How can researchers address solubility challenges when working with recombinant MPN_195?

The hydrophobic nature of MPN_195 presents significant solubility challenges requiring specialized approaches:

Prevention strategies during expression:

  • Expression optimization:

    • Lower temperatures (16-18°C) to slow folding

    • Reduced inducer concentrations (0.1-0.2 mM IPTG)

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

  • Construct design:

    • Removal of predicted transmembrane domains for soluble fragment expression

    • Fusion to solubility enhancers (MBP, SUMO, thioredoxin)

    • Terminal tag positioning optimization

Solubilization approaches post-expression:

  • Detergent screening panel:

    • Mild detergents (DDM, LMNG) for membrane protein extraction

    • Concentration optimization (typically 1-2% for extraction, 0.05-0.1% for purification)

    • Detergent exchange during purification

  • Alternative solubilization strategies:

    • Amphipols for detergent-free handling

    • Nanodiscs for native-like membrane environment

    • SMALPs (styrene maleic acid lipid particles) for native lipid preservation

Recovery methods for inclusion bodies:

  • Denaturation protocols using 8M urea or 6M guanidinium-HCl

  • Step-wise dialysis for controlled refolding

  • On-column refolding during IMAC purification

When working with lyophilized MPN_195, following the recommended reconstitution protocol with 6% trehalose in Tris/PBS buffer at pH 8.0 has been shown to maintain protein stability .

What strategies can resolve contradictory results in MPN_195 functional studies?

When faced with contradictory experimental results, a systematic troubleshooting approach is essential:

Source identification strategies:

  • Technical variation analysis:

    • Standardize protocols across laboratories

    • Implement positive and negative controls consistently

    • Verify reagent quality and consistency (antibodies, recombinant proteins)

  • Biological variation consideration:

    • M. pneumoniae strain differences (subtype 1 vs. subtype 2)

    • Growth condition variation affecting protein expression

    • Host cell type differences in interaction studies

  • Methodological limitations assessment:

    • Sensitivity and specificity limits of each technique

    • Potential artifacts introduced by tags or expression systems

    • In vitro vs. in vivo context differences

Resolution approaches:

  • Orthogonal method validation:

    • Confirm key findings using independent methodologies

    • Triangulate results using complementary approaches

    • Consider both gain-of-function and loss-of-function approaches

  • Contextual experimental design:

    • Recreate physiologically relevant conditions

    • Consider temporal aspects (protein life cycle, expression timing)

    • Examine concentration-dependence of observed effects

  • Collaborative cross-validation:

    • Inter-laboratory validation studies

    • Sharing of standardized reagents and protocols

    • Blind experimental replication

For uncharacterized proteins like MPN_195, apparent contradictions may actually reflect multiple functions or context-dependent behaviors, warranting careful interpretation rather than dismissal.

How should researchers interpret the absence of phenotypes in MPN_195 genetic modification studies?

The absence of observable phenotypes following genetic manipulation presents a common challenge that requires careful analysis:

Explanation assessment framework:

  • Technical considerations:

    • Confirm genetic modification success (sequencing, RT-PCR, Western blot)

    • Verify assay sensitivity to detect subtle phenotypes

    • Ensure appropriate time points for observation

  • Biological redundancy possibilities:

    • Functional compensation by homologous proteins

    • Activation of alternative pathways

    • Context-dependent essentiality

  • Condition-specific functionality:

    • Test multiple growth conditions (nutrient limitation, stress)

    • Examine infection models rather than laboratory culture

    • Consider host cell interaction phenotypes

Advanced investigation approaches:

  • Combined genetic modifications:

    • Double/triple knockouts to address redundancy

    • Synthetic genetic array analysis to identify interactions

    • Combinatorial gene repression using CRISPRi

  • Sensitive phenotyping methods:

    • Competitive growth assays for subtle fitness effects

    • High-content screening for morphological changes

    • Omics profiling (transcriptomics, proteomics, metabolomics)

  • Evolutionary approaches:

    • Experimental evolution under selective pressure

    • Comparative analysis across Mycoplasma species

    • Ancestral sequence reconstruction and complementation

In minimal genome organisms like M. pneumoniae, the retention of genes typically indicates functionality, even when not immediately evident in laboratory conditions . The absence of phenotypes may reflect our incomplete understanding of the protein's natural context rather than lack of function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.