Recombinant Mycoplasma pneumoniae Uncharacterized protein MG233 homolog (MPN_326)

Shipped with Ice Packs
In Stock

Description

Genomic Context

  • Gene Locus: MPN_326 is part of the M. pneumoniae genome, which is highly reduced (≈800 kb) and lacks cell wall synthesis pathways .

  • Homologs: Shares homology with MG233, a protein of unknown function in related mycoplasma species .

Diagnostic Development

MPN_326 is commercially available as an ELISA reagent (e.g., CSB-CF301126MLW) , with applications in:

  • Serological assays for detecting M. pneumoniae infections.

  • Antigen-antibody interaction studies to map immunodominant regions.

Vaccine Research

Though not yet tested in vaccine trials, recombinant mycoplasma proteins (e.g., MPN_641) are being explored as candidates due to their surface exposure and immunogenicity . MPN_326’s lipoprotein nature makes it a potential target for humoral immunity studies.

Comparative Analysis with Other Mycoplasma Proteins

ProteinGeneFunctionExpression SystemKey Applications
MPN_326MPN_326Uncharacterized lipoprotein homologE. coliELISA, basic research
MPN_469 (MG323.1 Homolog)MPN_469Adhesion-related (hypothetical)E. coliSDS-PAGE, structural studies
MPN_262 (MG123 Homolog)MPN_262UnknownE. coliProtein interaction assays

Data sources:

Challenges and Future Directions

  • Functional Characterization: No peer-reviewed studies directly investigate MPN_326’s role in M. pneumoniae pathogenesis.

  • Clinical Relevance: Rising macrolide-resistant M. pneumoniae infections underscore the need to identify novel therapeutic targets, including uncharacterized proteins.

  • Structural Biology: Cryo-EM or X-ray crystallography could resolve MPN_326’s 3D structure, aiding functional predictions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_326; F10_orf100a; MP510; Uncharacterized protein MG233 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_326
Target Protein Sequence
MIKLTVSHHKLTASGHALFAKKGQDIVCAAVSGIIFGALPWFETNSIAVQEDATVPSLSL ELVQPTAKLITGLSVVIMQLKTLAHSYPQFISFEDQRKDE
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN326

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Mycoplasma pneumoniae Uncharacterized protein MG233 homolog (MPN_326)?

The MPN_326 protein is an uncharacterized protein encoded by the genome of Mycoplasma pneumoniae (strain ATCC 29342 / M129). According to available sequence data, it consists of 100 amino acids and has the UniProt accession number P75459. This protein is homologous to the MG233 protein, with the gene being located at the MPN_326 locus. Alternative names in the literature include ORF names F10_orf100a and MP510 . As an uncharacterized protein, its biological function remains to be definitively determined, making it a candidate for functional prediction through computational and experimental methods.

What structural information is currently available for MPN_326?

Currently, detailed structural information (such as crystal structure or NMR data) for MPN_326 appears limited in the available literature. Based on standard protein analysis approaches, researchers typically use predictive tools to generate preliminary structural insights:

  • Primary structure: The 100-amino acid sequence as provided above

  • Secondary structure: Prediction tools would typically analyze the sequence for alpha-helices, beta-sheets, and random coils

  • Tertiary structure: Homology modeling might be possible if sufficiently similar proteins with known structures exist

For experimental determination of structure, researchers would need to express and purify the recombinant protein, then use X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy techniques .

How can phylogenetic profiling be used to predict the function of MPN_326?

Phylogenetic profiling is a powerful computational approach for predicting protein function based on evolutionary patterns across multiple organisms. For MPN_326, this method would involve:

  • Creating a phylogenetic profile: Generate a binary vector (profile) indicating the presence (1) or absence (0) of MPN_326 homologs across multiple genomes.

  • Comparative analysis: Compare this profile with those of characterized proteins. Proteins with similar profiles are likely to be functionally linked (participating in the same pathway or complex).

  • Functional prediction: If MPN_326's profile closely matches proteins involved in a specific pathway or function, it suggests MPN_326 may serve a similar role.

A study by Pellegrini et al. demonstrated that proteins with matching or similar phylogenetic profiles have an 18% keyword overlap in their functional annotations, compared to only 4% for random proteins, suggesting this method can predict functions with reasonable accuracy .

Table 1: Example Structure of a Phylogenetic Profile Analysis for MPN_326

OrganismMPN_326 Homolog PresentProtein XProtein YProtein Z
E. coli0010
B. subtilis1101
H. influenzae1101
S. cerevisiae0001
[Other genomes...]............
Profile similarity score-85%25%65%

This approach becomes more statistically robust as more genomes are included in the analysis. While the original method used 16 genomes, modern analyses can incorporate over 100 genomes for higher resolution and accuracy .

What experimental approaches are recommended for characterizing the function of MPN_326?

Characterizing an uncharacterized protein like MPN_326 typically requires a multi-faceted approach:

  • Recombinant protein expression and purification:

    • Express the protein in a suitable host system (E. coli, yeast, or insect cells)

    • Optimize expression conditions (temperature, induction time, media components)

    • Purify using affinity chromatography, potentially as a tagged protein (His-tag or GST-tag)

    • Verify purity by SDS-PAGE and Western blotting

  • Functional assays:

    • Enzymatic activity assays based on predictions from sequence similarity or phylogenetic profiling

    • Protein-protein interaction studies (pull-down assays, yeast two-hybrid, or co-immunoprecipitation)

    • Cellular localization studies using fluorescent tags or immunofluorescence

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy for secondary structure estimation

    • X-ray crystallography or NMR for detailed structural analysis

    • Cryo-EM for larger complexes

  • Gene knockout/knockdown studies:

    • Create deletion mutants in M. pneumoniae (if genetic tools available)

    • Observe phenotypic changes to infer function

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify co-expressed genes

    • Proteomics to identify interaction partners

  • In silico analyses:

    • Sequence comparison with characterized proteins

    • Structural prediction and modeling

    • Phylogenetic profiling as described above

Given the amino acid sequence and recombinant protein availability, researchers can design specific experiments based on preliminary functional hypotheses derived from computational predictions .

How might MPN_326 contribute to Mycoplasma pneumoniae pathogenicity?

To investigate potential roles of MPN_326 in pathogenicity, researchers should consider:

  • Expression analysis during infection:

    • Quantify mRNA and protein levels at different stages of infection

    • Compare expression between virulent and avirulent strains

    • Analyze expression under various stress conditions mimicking host environments

  • Host-pathogen interaction studies:

    • Test binding of purified MPN_326 to host cell components

    • Investigate if MPN_326 modulates host immune responses

    • Examine localization during infection using immunofluorescence microscopy

  • Functional inactivation:

    • Create knockout or knockdown mutants and assess virulence in cell culture or animal models

    • Complementation studies to confirm phenotype is due to MPN_326 loss

  • Structural analysis of potential virulence mechanisms:

    • Identify structural motifs similar to known virulence factors

    • Examine presence of secretion signals or host-targeting sequences

  • Comparative genomics:

    • Compare MPN_326 presence and sequence variation across clinical isolates with different virulence profiles

    • Analyze gene neighborhood for co-localization with known virulence factors

While current literature doesn't explicitly link MPN_326 to pathogenicity, these approaches would help elucidate any potential role in Mycoplasma pneumoniae virulence mechanisms .

How can molecular subtyping techniques integrate MPN_326 analysis for epidemiological studies?

Molecular subtyping of Mycoplasma pneumoniae has traditionally focused on the P1 gene, as described in existing studies. To incorporate MPN_326 analysis into epidemiological research:

  • Sequence variation analysis:

    • Determine if MPN_326 contains variable regions that could serve as subtyping markers

    • Compare variation patterns with established subtyping markers like P1

  • Development of culture-independent detection methods:

    • Design primers targeting MPN_326 for PCR-based detection directly from clinical samples

    • Establish sequencing protocols for the variable regions identified

  • Correlation with clinical outcomes:

    • Analyze whether specific MPN_326 variants correlate with disease severity, antibiotic resistance, or transmission patterns

    • Investigate potential functional implications of sequence variants

  • Integrated multi-locus approach:

    • Combine MPN_326 analysis with existing markers (like P1 gene) for higher resolution subtyping

    • Develop algorithms that integrate data from multiple genetic markers

For implementation, researchers could adapt the culture-independent molecular subtyping approach described for the P1 gene. This involves PCR amplification and sequencing of target regions directly from clinical samples, allowing rapid characterization of endemic and epidemic M. pneumoniae infections .

What computational pipelines are most effective for predicting protein-protein interactions involving MPN_326?

To predict protein-protein interactions (PPIs) involving MPN_326, researchers should consider implementing a multi-algorithm approach:

  • Phylogenetic profiling-based methods:

    • Identify proteins with matching phylogenetic profiles across multiple genomes

    • Calculate profile similarity scores using metrics like Hamming distance or mutual information

    • Prioritize proteins with statistically significant profile matches

  • Structural docking simulations:

    • Generate 3D models of MPN_326 using homology modeling or ab initio prediction

    • Perform molecular docking with potential interaction partners

    • Evaluate binding energy and interface complementarity

  • Genomic context methods:

    • Analyze gene neighborhood conservation

    • Identify gene fusion events that might indicate functional relationships

    • Examine coinheritance patterns across species

  • Machine learning approaches:

    • Train models on known PPIs using sequence features, domain information, and evolutionary data

    • Apply trained models to predict MPN_326 interactions

    • Validate predictions with experimental data

  • Network-based inference:

    • Integrate existing PPI data for M. pneumoniae and related organisms

    • Use graph theory algorithms to predict missing interactions

    • Identify potential interaction modules or complexes

Table 2: Comparison of Computational PPI Prediction Methods for Uncharacterized Proteins

MethodData RequirementsResolutionStrengthsLimitations
Phylogenetic ProfilingMultiple genome sequencesPathway/complex levelDetects functionally linked proteinsCannot resolve direct vs. indirect interactions
Structural DockingProtein structures (experimental or modeled)Residue levelProvides interaction mechanism insightsComputationally intensive; requires accurate structures
Genomic ContextGenome sequences with annotationOperon/gene cluster levelLeverages evolutionary conservationLimited to prokaryotes for some approaches
Machine LearningTraining data from known PPIsVariesCan integrate diverse featuresPerformance depends on training data quality
Network InferenceExisting PPI networksSystem levelCaptures complex interaction patternsPropagates existing network biases

Research by Pellegrini et al. demonstrated that phylogenetic profiling alone can achieve significant functional linkage prediction, with proteins in the same structural complex or metabolic pathway showing similar profiles. The integration of multiple computational approaches would provide higher confidence predictions for MPN_326 interacting partners .

What are the optimal conditions for expressing recombinant MPN_326 protein in bacterial systems?

Based on recombinant protein expression principles and the characteristics of MPN_326:

  • Expression system selection:

    • E. coli BL21(DE3) is typically suitable for small proteins like MPN_326 (100 amino acids)

    • Consider Rosetta or Origami strains if codon usage bias or disulfide bonding is an issue

  • Vector design:

    • Include an affinity tag (6xHis or GST) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include a precision protease cleavage site for tag removal

  • Expression conditions optimization:

    • Temperature: Test expression at 37°C, 30°C, 25°C, and 18°C

    • Induction: Compare IPTG concentrations (0.1-1.0 mM)

    • Duration: Test 3h, 6h, and overnight induction periods

    • Media: LB, TB, or auto-induction media

  • Solubility enhancement strategies:

    • Co-expression with chaperones (GroEL/ES, DnaK)

    • Addition of solubility enhancers to lysis buffer (glycerol, mild detergents)

    • Test various pH conditions (pH 6.0-8.0)

Table 3: Recommended Expression Condition Matrix for MPN_326

ParameterCondition 1Condition 2Condition 3Condition 4
Host StrainBL21(DE3)BL21(DE3)pLysSRosetta(DE3)ArcticExpress
Temperature37°C30°C25°C16°C
IPTG Concentration0.1 mM0.5 mM1.0 mMAuto-induction
Duration3 hours6 hoursOvernightOvernight
MediaLBTB2xYTZYM-5052

For initial purification, use a Tris-based buffer with 50% glycerol as described in the product information, which has been optimized for this specific protein .

What approaches should be used to resolve contradictory functional predictions for MPN_326?

When faced with contradictory functional predictions for an uncharacterized protein like MPN_326:

  • Systematically evaluate prediction confidence:

    • Compare statistical significance of each prediction

    • Assess the quality of underlying data supporting each prediction

    • Consider the track record of each prediction method

  • Design discriminatory experiments:

    • Identify tests that can specifically distinguish between predicted functions

    • Prioritize direct functional assays over indirect evidence

    • Include positive and negative controls for each predicted function

  • Hierarchical validation approach:

    • Begin with broad functional category validation

    • Progressively test more specific functional hypotheses

    • Use orthogonal experimental techniques

  • Integrated data analysis:

    • Combine results from multiple prediction methods using Bayesian integration

    • Weight predictions based on confidence scores

    • Consider evolutionary conservation as a validation metric

  • Consider multifunctionality:

    • Test if the protein might perform multiple functions (moonlighting)

    • Examine if contradictory predictions might reflect different aspects of a complex function

  • Context-dependent function:

    • Test function under different physiological conditions

    • Investigate potential binding partners that might alter function

    • Examine expression patterns for clues to contextual relevance

In specific cases of contradictory predictions from phylogenetic profiling, researchers should examine the profile similarity threshold used, as Pellegrini et al. found that proteins with profiles differing by just one bit can still be functionally linked. Additionally, as more genomes become available for profiling (expanding from the original 16 to potentially 100+ genomes), the resolution and accuracy of functional prediction would improve significantly .

How should researchers interpret phylogenetic profiling results for MPN_326 in the context of emerging genomic data?

Interpreting phylogenetic profiling results for MPN_326 requires careful consideration of several factors:

  • Profile resolution enhancement:

    • As noted by Pellegrini et al., the original phylogenetic profiling method used 16 genomes. Current genomic databases contain hundreds of fully sequenced genomes

    • Recalculate profiles using expanded genome sets, potentially increasing from 16 bits to 100+ bits

    • Consider hierarchical profiling that groups organisms by taxonomic distance

  • Statistical significance assessment:

    • Calculate probability of profile similarity occurring by chance

    • Establish appropriate similarity thresholds based on genome selection

    • Consider mutual information metrics rather than simple Hamming distance

  • Functional group resolution:

    • Initial profiling may group proteins from related but distinct pathways

    • With expanded genome sets, expect better separation of distinct pathways

    • For example, histidine biosynthesis proteins might cluster separately from other amino acid synthesis pathways with more genomes

  • Evolutionary interpretation:

    • Consider genome reduction in Mycoplasma species when interpreting profiles

    • Assess horizontal gene transfer events that might confound phylogenetic patterns

    • Account for different evolutionary rates across protein families

  • Integration with other evidence:

    • Combine profiling results with structural predictions, genomic context, and experimental data

    • Weight evidence based on confidence levels

    • Resolve apparent contradictions by examining underlying assumptions

Researchers should note that Pellegrini et al. found that proteins with identical or similar phylogenetic profiles have an 18% keyword overlap in their functional annotations compared to 4% for random proteins, suggesting that profile similarity is a strong indicator of functional linkage. As the number of available genomes increases, the statistical power and resolution of this method will continue to improve .

What bioinformatic workflow is recommended for identifying structural domains and motifs in MPN_326?

A comprehensive bioinformatic workflow for structural analysis of MPN_326 should include:

  • Primary sequence analysis:

    • Compute physicochemical properties (hydrophobicity, charge distribution, etc.)

    • Identify compositionally biased regions

    • Predict secondary structure elements (α-helices, β-sheets)

    • Analyze sequence complexity and disorder propensity

  • Domain and motif identification:

    • Search against domain databases (Pfam, SMART, ProSite)

    • Identify short linear motifs (SLiMs) using ELM or similar tools

    • Detect transmembrane regions and signal peptides

    • Identify potential post-translational modification sites

  • Homology-based structural prediction:

    • Perform sensitive sequence similarity searches (PSI-BLAST, HHpred)

    • Identify remote homologs with known structures

    • Generate multiple sequence alignments with structural homologs

    • Create homology models using tools like SWISS-MODEL or Phyre2

  • Ab initio and template-free modeling:

    • Apply AlphaFold2 or RoseTTAFold for high-confidence structural prediction

    • Validate predictions using energy minimization

    • Assess model quality with QMEAN, MolProbity, or similar tools

  • Structural analysis and annotation:

    • Identify potential binding sites and catalytic residues

    • Analyze surface electrostatics and hydrophobicity

    • Detect structural motifs shared with functionally characterized proteins

    • Perform molecular dynamics simulations to assess stability

  • Functional implication analysis:

    • Map conservation patterns onto structural models

    • Identify structurally similar proteins with known functions

    • Predict binding interfaces and potential interaction partners

    • Generate testable hypotheses based on structural features

This systematic approach leverages both sequence-based and structure-based analysis methods to maximize the information extracted from the MPN_326 sequence. The results should guide experimental design for functional characterization and provide context for interpreting phylogenetic profiling results .

How might research on MPN_326 contribute to understanding minimal genome concepts in synthetic biology?

Mycoplasma pneumoniae has one of the smallest genomes among self-replicating organisms, making it relevant for minimal genome research in synthetic biology. MPN_326 research could contribute to this field in several ways:

  • Essential gene identification:

    • Determine if MPN_326 is essential for M. pneumoniae viability

    • Map its interactions with known essential proteins

    • Assess conservation across minimal genome designs

  • Functional annotation implications:

    • Complete functional characterization would reduce the percentage of uncharacterized proteins in this minimal genome

    • Could reveal novel metabolic capabilities or regulatory mechanisms in minimal systems

    • May identify functions previously thought unnecessary in minimal genomes

  • Synthetic biology applications:

    • Evaluate MPN_326 for inclusion in synthetic minimal genomes

    • Determine if it represents a genus-specific adaptation that could be engineered

    • Potential use as a bioproduction platform component

  • Evolutionary insights:

    • Analyze how selective pressures maintain uncharacterized proteins in highly reduced genomes

    • Explore whether MPN_326 represents a specialized adaptation or ancestral function

    • Examine gene persistence despite genome reduction

  • Methodological advancement:

    • Test whether phylogenetic profiling methods are equally effective for proteins from minimal genomes

    • Develop optimized approaches for functional prediction in reduced genome contexts

    • Compare prediction accuracy between minimal and complex genomes

The application of phylogenetic profiling methods, as described by Pellegrini et al., would be particularly valuable in this context, as they can connect MPN_326 to functional pathways even without sequence similarity to characterized proteins—a common challenge in minimal genome research .

What role might MPN_326 play in the development of molecular diagnostic tools for Mycoplasma pneumoniae infections?

The potential application of MPN_326 in molecular diagnostics for M. pneumoniae infections could be explored through:

  • Biomarker assessment:

    • Evaluate sequence conservation of MPN_326 across clinical isolates

    • Determine specificity to M. pneumoniae versus other Mycoplasma species

    • Assess expression levels during infection to gauge detection sensitivity

  • Diagnostic assay development:

    • Design specific PCR primers targeting MPN_326

    • Develop antibodies against MPN_326 for immunoassays

    • Create recombinant protein standards for quantitative assays

  • Integration with existing molecular subtyping approaches:

    • Compare discriminatory power with established markers like the P1 gene

    • Evaluate potential for multiplexed detection with other genetic markers

    • Assess correlation between MPN_326 variants and clinical presentations

  • Culture-independent detection methods:

    • Adapt the culture-independent molecular subtyping approach developed for P1 gene to include MPN_326

    • Design protocols for direct detection from clinical samples

    • Establish sequencing workflows for variant identification

  • Epidemiological applications:

    • Track transmission patterns using MPN_326 sequence variations

    • Monitor evolution of the protein across outbreaks

    • Correlate specific variants with geographical distribution

The culture-independent molecular approach described by researchers for P1 gene subtyping could be expanded to include MPN_326, potentially increasing the resolution and accuracy of M. pneumoniae detection and characterization in clinical samples .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.