Recombinant Mycoplasma pneumoniae Uncharacterized protein MG241 homolog (MPN_337)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format preference, please specify it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, kindly consult your local distributors.
All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as an additional fee will be incurred.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For convenience, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for extended storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of the protein is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_337; F10_orf621; MP499; Uncharacterized protein MG241 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_337
Target Protein Sequence
MVKKELEMYNLYTFQIDLDKKLLFEKADNQQNYSKIRARYFKNSARNQQAVFLNKNLIKN TFNKALLNFSDFLSGSGVESIFKQVIDDQPEVLNYLKQVKKEDSCDGHSEASQLVFNVVI NPKNTLANFFEELTIYLHFNEENNTVVGSFSLKWNIKRADLFSETKNIAINNLIHTFCKN NLNEVSFIQIIKCFAKTLINKQGQIVLESCAFKQKWQNIVEQKYPFSTIHKNLKIVNSDF FDAFFVILLLICHLNNNLLWLCEKTEHFEWKLNSKISNFKEDNTEVYLSKMLLFLKDWYF ENQAVTNEDIEKVDEVEDIGKLVEKYSANQPQKLSSNSTVYVFEPDKKQCFLKNDDFFNT NEAKLLFLITMQPNVFGLDDTAIANDLNLREIGDFFKEIDFTDSDVLNDFQQQKETLLVR RTFNQLLFMNSNTDVLSIVNNKFKSAIHNIVWTITYSKAIMLKAFDYSKIFEQNRTNDPS LLRSNLNSINRLRYLSEYFRTASVKYDQLYTKVKEYMQLDQFLVDMINQVNHEDEIFGKY KERVYLSLGIVTAVVFGIIEFFNCVWTVLTVSQQTAEKSLADPRNTVIIGIGTILVLTLL ITILTFMTRRLYLFEFNKKHK
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN337

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_337 and what organism does it come from?

MPN_337 is an uncharacterized protein from Mycoplasma pneumoniae, a wall-less bacterium known to cause respiratory tract infections in humans. This protein consists of 621 amino acids and is homologous to the MG241 protein. While its specific function remains to be fully elucidated, understanding this protein may provide insights into M. pneumoniae pathogenesis, which has been a subject of investigation for over 50 years .

How does MPN_337 relate to M. pneumoniae pathogenesis?

While MPN_337's specific role in pathogenesis remains uncharacterized, research on M. pneumoniae has identified various virulence mechanisms. Unlike many bacterial pathogens that produce classical toxins, M. pneumoniae employs distinctive pathogenic strategies. For context, other M. pneumoniae proteins like MPN372 have been identified as virulence factors with ADP-ribosyltransferase activity that can damage respiratory epithelium . As an uncharacterized protein, MPN_337 may potentially contribute to pathogenesis through similar or novel mechanisms, warranting further investigation into its function during infection processes .

What expression systems are most effective for recombinant MPN_337 production?

E. coli expression systems have been successfully employed for recombinant MPN_337 production with an N-terminal His tag . When designing your expression system, consider these methodological recommendations:

  • Codon optimization: Since M. pneumoniae uses UGA to encode tryptophan rather than as a stop codon (unlike E. coli), codon optimization is crucial for effective heterologous expression.

  • Expression vector selection: Vectors with inducible promoters (such as T7) offer better control over protein expression timing and levels.

  • Fusion tags: The His-tag approach has been validated for MPN_337 , but alternative tags (GST, MBP) might be considered if solubility issues arise.

  • Host strain selection: BL21(DE3) derivatives are often suitable, but strains designed for membrane or toxic proteins may be necessary depending on protein characteristics.

An effective experimental design would include testing multiple expression conditions with proper controls to optimize yield and solubility .

What are the recommended storage and handling protocols for recombinant MPN_337?

Based on empirical data, the following storage and handling protocols are recommended for maintaining MPN_337 stability and activity:

ParameterRecommendationRationale
Storage temperature-20°C/-80°CMinimizes protein degradation over time
Buffer compositionTris/PBS-based, pH 8.0, with 6% TrehaloseMaintains protein stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization
Cryoprotectant5-50% glycerol (final concentration)Prevents damage from freeze-thaw cycles
AliquotingMultiple small volumesAvoids repeated freeze-thaw cycles
Working storage4°C for up to one weekSuitable for ongoing experiments

Repeated freeze-thaw cycles should be strictly avoided as they lead to significant protein degradation and functional loss . A well-designed experimental protocol would include stability testing under various conditions to verify these recommendations for specific research applications .

How should researchers design experiments to investigate MPN_337 function?

When designing experiments to elucidate MPN_337 function, apply these methodological principles:

This systematic approach allows for robust data collection while minimizing resource expenditure, a key consideration in experimental design .

How can structural studies of MPN_337 be approached methodologically?

Structural characterization of MPN_337 requires a multi-technique approach:

  • Bioinformatic analysis:

    • Secondary structure prediction

    • Homology modeling based on related structures

    • Domain identification and functional prediction

  • Experimental structure determination:

    • X-ray crystallography: Requires high-purity, homogeneous protein preparations; screening multiple crystallization conditions

    • NMR spectroscopy: Suitable for flexible regions; requires isotope-labeled protein

    • Cryo-EM: Particularly valuable if MPN_337 forms larger complexes or has membrane-associated domains

  • Structural validation:

    • Limited proteolysis to identify domain boundaries

    • Circular dichroism to confirm secondary structure elements

    • Thermal shift assays to assess stability and ligand interactions

  • Structure-function correlation:

    • Site-directed mutagenesis of key residues identified in the structure

    • Functional assays to correlate structural features with biochemical activities

This methodological framework enables progressive understanding of MPN_337's structural basis for function, which is critical for uncharacterized proteins .

How might MPN_337 interact with host cells during M. pneumoniae infection?

To investigate potential MPN_337-host interactions, consider these methodological approaches:

  • Localization studies:

    • Determine if MPN_337 remains bacterial-associated or is secreted

    • Immunolocalization during infection to track protein distribution

  • Binding partner identification:

    • Pull-down assays using tagged recombinant MPN_337

    • Co-immunoprecipitation from infected cells

    • Yeast two-hybrid or BioID proximity labeling approaches

    • Mass spectrometry analysis of protein complexes

  • Host response assessment:

    • Transcriptomic/proteomic profiling of host cells exposed to purified MPN_337

    • Cytokine/inflammatory mediator measurement

    • Cell morphology and viability monitoring

  • Functional validation:

    • Knockdown/knockout studies in M. pneumoniae

    • Complementation assays

    • Expression of MPN_337 in heterologous systems

For context, other M. pneumoniae proteins like MPN372 have been shown to possess ADP-ribosyltransferase activity and induce vacuolization and cell death in mammalian cells . Similar methodological approaches could reveal whether MPN_337 contributes to pathogenesis through host cell interactions .

What approaches can be used to study post-translational modifications of MPN_337?

Post-translational modifications (PTMs) may be critical for MPN_337 function. A comprehensive methodological approach includes:

  • PTM prediction:

    • Computational analysis of sequence for modification motifs

    • Comparison with known modified proteins in related species

  • Mass spectrometry-based identification:

    • Bottom-up proteomics with enrichment for specific modifications

    • Top-down proteomics for intact protein analysis

    • Targeted mass spectrometry for specific sites of interest

  • PTM site validation:

    • Site-directed mutagenesis of predicted modification sites

    • Antibodies specific to modified forms

    • Functional assays comparing wild-type and modification-deficient variants

  • Enzymatic modifiers identification:

    • Co-expression with candidate modifying enzymes

    • In vitro modification assays

    • Inhibition studies in cellular contexts

These approaches allow for comprehensive characterization of PTMs that might regulate MPN_337 function or localization within the bacterial cell or during host interaction.

How can researchers address solubility issues with recombinant MPN_337?

Solubility challenges are common with recombinant proteins. Apply these methodological solutions:

  • Expression optimization:

    • Reduce expression temperature (16-20°C)

    • Decrease inducer concentration

    • Use slower induction approaches

  • Buffer optimization:

    • Screen multiple pH conditions (typically 6.0-9.0)

    • Test various salt concentrations (50-500 mM)

    • Evaluate stabilizing additives (glycerol, trehalose, arginine)

  • Protein engineering approaches:

    • Express individual domains separately

    • Remove hydrophobic regions

    • Use solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

  • Refolding strategies (if inclusion bodies form):

    • Develop gradual dialysis protocols

    • Test various redox conditions

    • Employ molecular chaperones

For MPN_337 specifically, the documented success with His-tagged expression in E. coli suggests that the protein can be produced in soluble form under appropriate conditions .

How should researchers approach contradictory results in MPN_337 studies?

When facing contradictory results, apply this systematic troubleshooting methodology:

  • Data validation:

    • Repeat experiments with additional replicates

    • Verify protein identity by mass spectrometry

    • Confirm activity using alternative assays

  • Variable identification:

    • Document all experimental variables systematically

    • Create a table comparing conditions between experiments

    • Test one variable at a time to identify critical factors

  • Statistical reassessment:

    • Evaluate power calculations to ensure adequate sample size

    • Apply appropriate statistical tests for the data distribution

    • Consider Bayesian approaches for complex data sets

  • Contextual integration:

    • Compare results with related proteins (e.g., MPN372)

    • Evaluate if contradictions reflect true biological complexity

    • Consider if different experimental systems might yield different results

This structured approach ensures that contradictions become opportunities for deeper understanding rather than roadblocks to research progress .

What controls are essential for functional studies of MPN_337?

Robust experimental design for MPN_337 functional studies requires these methodological controls:

  • Protein-specific controls:

    • Heat-denatured MPN_337 (negative control)

    • Site-directed mutants of predicted functional residues

    • Related proteins with known function (positive controls)

  • Assay controls:

    • Buffer-only conditions

    • Irrelevant proteins of similar size/structure

    • Full validation of assay using established protein standards

  • Biological context controls:

    • Wild-type vs. MPN_337 knockout M. pneumoniae

    • Complementation studies

    • Dose-response relationships

  • Technical controls:

    • Multiple protein preparations to ensure reproducibility

    • Inter-laboratory validation where possible

    • Alternative methods for critical findings

What bioinformatic tools are most appropriate for analyzing MPN_337?

A comprehensive bioinformatic analysis of MPN_337 should employ these methodological approaches:

  • Sequence analysis:

    • Multiple sequence alignment with homologs

    • Conservation analysis across Mycoplasma species

    • Identification of functional motifs and domains

  • Structural prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Tertiary structure modeling (AlphaFold, SWISS-MODEL)

    • Disorder prediction (PONDR, IUPred)

  • Functional prediction:

    • Gene ontology mapping

    • Pathway analysis

    • Protein-protein interaction networks

    • Virulence factor database comparisons

  • Expression analysis:

    • Transcriptomic data integration

    • Co-expression network analysis

    • Expression changes during infection

This multi-faceted approach provides complementary perspectives on potential functions, guiding experimental design and interpretation of results for this uncharacterized protein.

How can researchers differentiate between direct and indirect effects of MPN_337?

Distinguishing direct from indirect effects requires rigorous methodological approaches:

  • In vitro reconstitution:

    • Purified component systems

    • Defined biochemical assays

    • Direct binding measurements (SPR, ITC, MST)

  • Temporal analysis:

    • Time-course experiments

    • Pulse-chase approaches

    • Inducible expression systems

  • Proximity-based methods:

    • FRET/BRET for protein-protein interactions

    • Crosslinking mass spectrometry

    • BioID or APEX2 proximity labeling

  • Genetic approaches:

    • Targeted mutations of interaction interfaces

    • Suppressor screens

    • Genetic interaction mapping

These strategies help establish causality rather than correlation, a critical distinction when characterizing novel proteins like MPN_337 whose function may influence multiple cellular processes .

What statistical considerations are important when analyzing MPN_337 functional data?

  • Experimental design statistics:

    • A priori power analysis to determine sample size

    • Randomization and blocking strategies to reduce variability

    • Prevention of pseudo-replication by ensuring true independent replicates

  • Data analysis approaches:

    • Appropriate tests based on data distribution

    • Multiple testing correction for high-throughput data

    • Effect size calculation alongside p-values

  • Advanced statistical considerations:

    • Mixed models for complex experimental designs

    • Bootstrapping for robust parameter estimation

    • Bayesian approaches for integrating prior knowledge

  • Reporting standards:

    • Complete methodological transparency

    • Raw data availability

    • Comprehensive error reporting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.