Recombinant Mycoplasma pneumoniae Uncharacterized protein MG255 homolog (MPN_358)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG255 homolog (MPN_358) is a protein derived from the bacterium Mycoplasma pneumoniae, also known as Mycoplasmoides pneumoniae . M. pneumoniae is a microorganism lacking a cell wall that causes chronic respiratory infections in humans . MPN_358 is a protein of currently unknown function, but research suggests its potential involvement in bacterial processes .

Basic Information

FeatureDescription
NameRecombinant Mycoplasma pneumoniae Uncharacterized protein MG255 homolog (MPN_358)
SynonymsMPN_358, H91_orf534, MP478, Uncharacterized protein MG255 homolog
Source OrganismMycoplasma pneumoniae (strain ATCC 29342 / M129)
Protein LengthFull Length: 534 amino acids
UniProt IDP75422
Amino Acid SequenceMETQNQIETLRYIFNQLNNQDKPQIIWFSGEGEDEKINFLIRLDNYFQPTFVQDLTINFL PAFVKRNKKNPPNTLAKGNFVNIANKLLAVLARSLSWKQLNKPQQKWLLWLLVPFLLLRQ LWLKKKVSKIFQFVNERGILSFIKEQWPILTTLVTVGTTLGTPIFSITISQQKAILENAG HGAFVFLVIFSVFAIALGLVSSLIFLVSSLFSIRQKKSLQQLHQILSRLINKYFCFANSE QNQTGRYQLKNTGVCFFYGFDFEEKEYITQAMNLLLLLKQTNCFVLVGCKESNMLLIKNK VEPDINLKQSSLYLDLKSQISPLAQISKYNLLFEELALDADMFYLEDFFALLKTPRQIVN FLFRIKQNLKEFHQPQTLWFDYLALWALVIATDFEFNNVLWSFNDYLSLTNKQKEDYASV NLTAFFNRSLKNHKDNSLLFKPELFNTHAYIPETYTQVTLENIDSDKRAQLVPLNWFSQQ KFSDFIEEKINFWQTQQAENKVFYLTLGERIFFLVLVNKKFKQIKLEAALKYLN
Purity≥85% as determined by SDS-PAGE

Production and Characteristics

  • Expression: MPN_358 is often produced recombinantly in E. coli . The recombinant protein includes a Histidine tag (His-tag) at the N-terminus to facilitate purification .

  • Formulation: Recombinant MPN_358 is typically available as a lyophilized powder .

  • Reconstitution: The protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% is recommended for long-term storage at -20°C/-80°C .

  • Storage: Store at -20°C or -80°C upon receipt, with aliquoting to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week . Liquid form is generally stable for 6 months at -20°C/-80°C, while lyophilized form is stable for 12 months at -20°C/-80°C .

Potential Functions and Research Applications

While MPN_358 is currently annotated as an uncharacterized protein, its identification and recombinant production allows for research into its potential roles within Mycoplasma pneumoniae . Research has shown that M. pneumoniae can induce inflammatory responses in macrophages, and identifying the proteins involved is vital for understanding the pathogenesis of infections .

Potential research avenues include:

  • Protein Interactions: Identifying interacting partners of MPN_358 within M. pneumoniae to elucidate its functional role. Techniques like GST pull-down assays combined with mass spectrometry can be employed .

  • Structural Studies: Determining the three-dimensional structure of MPN_358, which could provide insights into its function.

  • Functional Assays: Developing and performing in vitro and in vivo assays to assess the protein's involvement in essential bacterial processes.

  • Role in Pathogenesis: Investigating the potential role of MPN_358 in the infection process, including adhesion, motility, and immune modulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MPN_358; H91_orf534; MP478; Uncharacterized protein MG255 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-534
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_358
Target Protein Sequence
METQNQIETLRYIFNQLNNQDKPQIIWFSGEGEDEKINFLIRLDNYFQPTFVQDLTINFL PAFVKRNKKNPPNTLAKGNFVNIANKLLAVLARSLSWKQLNKPQQKWLLWLLVPFLLLRQ LWLKKKVSKIFQFVNERGILSFIKEQWPILTTLVTVGTTLGTPIFSITISQQKAILENAG HGAFVFLVIFSVFAIALGLVSSLIFLVSSLFSIRQKKSLQQLHQILSRLINKYFCFANSE QNQTGRYQLKNTGVCFFYGFDFEEKEYITQAMNLLLLLKQTNCFVLVGCKESNMLLIKNK VEPDINLKQSSLYLDLKSQISPLAQISKYNLLFEELALDADMFYLEDFFALLKTPRQIVN FLFRIKQNLKEFHQPQTLWFDYLALWALVIATDFEFNNVLWSFNDYLSLTNKQKEDYASV NLTAFFNRSLKNHKDNSLLFKPELFNTHAYIPETYTQVTLENIDSDKRAQLVPLNWFSQQ KFSDFIEEKINFWQTQQAENKVFYLTLGERIFFLVLVNKKFKQIKLEAALKYLN
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN358

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_358 and what are its basic structural characteristics?

MPN_358 is an uncharacterized protein from Mycoplasma pneumoniae, a minimal prokaryotic organism capable of independent survival without a host cell . The protein consists of 534 amino acids in its full-length form . As an uncharacterized protein, its three-dimensional structure has not been fully elucidated through crystallography or other structural biology techniques.

Methodological approach for structural characterization:
Researchers should consider employing a combination of computational prediction tools (such as AlphaFold2 or RoseTTAFold) alongside experimental approaches including X-ray crystallography, NMR spectroscopy, or cryo-EM. For initial characterization, secondary structure prediction using circular dichroism spectroscopy can provide valuable insights into the protein's folding patterns. Expression optimization in E. coli systems has been successful for recombinant production .

What expression systems are most effective for producing recombinant MPN_358?

The most documented expression system for MPN_358 is E. coli . The protein has been successfully expressed as a His-tagged recombinant protein with the full sequence (amino acids 1-534).

Methodological approach for optimizing expression:
When designing an experimental protocol for expressing MPN_358:

  • Utilize the pET expression system in E. coli BL21(DE3) or similar strains

  • Consider codon optimization for improved expression

  • Test multiple induction conditions (IPTG concentration, temperature, duration)

  • Evaluate solubility and employ solubilization strategies if inclusion bodies form

  • Optimize purification using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

A systematic approach to expression optimization might include the following experimental conditions:

ParameterTest ConditionsEvaluation Method
E. coli strainBL21(DE3), Rosetta(DE3), Arctic ExpressSDS-PAGE, Western blot
Induction temperature16°C, 25°C, 37°CProtein yield, solubility analysis
IPTG concentration0.1mM, 0.5mM, 1.0mMDensitometry of protein bands
Induction time4h, 8h, overnightTime-course sampling

What experimental approaches are most suitable for determining the function of an uncharacterized protein like MPN_358?

As MPN_358 remains uncharacterized, a multi-faceted approach is necessary to elucidate its function.

Methodological approach for functional characterization:

  • Comparative genomics: Analyze homologs in related species, particularly MG255 in M. genitalium, to identify conserved domains and potential functions

  • Protein-protein interaction (PPI) studies: Employ yeast two-hybrid, pull-down assays, or proximity labeling approaches to identify interaction partners

  • Gene knockout/knockdown: Generate CRISPR-Cas9 knockouts or antisense RNA to assess phenotypic changes

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and MPN_358-deficient strains

  • Biochemical assays: Test for common enzymatic activities (kinase, phosphatase, protease, etc.)

For experimental design, researchers should consider the following structure:

ApproachSpecific MethodExpected OutcomeControls
Interactome analysisBioID proximity labelingIdentification of protein complexesBirA* alone, non-relevant protein
Loss-of-functionCRISPR interferenceGrowth phenotype, morphological changesNon-targeting sgRNA
TranscriptomicsRNA-seq of knockout vs. WTDifferentially expressed genesMultiple biological replicates
Domain mappingTruncation analysisFunctional domains identifiedFull-length protein

How can researchers effectively design experiments to study MPN_358's potential role in Mycoplasma pneumoniae pathogenesis?

M. pneumoniae is a significant pathogen causing community-acquired pneumonia, particularly in pediatric populations . Understanding MPN_358's potential role in pathogenesis requires specialized experimental approaches.

Methodological approach for pathogenesis studies:

  • Adherence assays: Test whether MPN_358 influences bacterial attachment to respiratory epithelial cells

  • Infection models: Compare wild-type and MPN_358-mutant strains in cell culture and animal models

  • Immune response assays: Measure cytokine production and immune cell activation in response to purified MPN_358

  • Localization studies: Determine subcellular localization and potential surface exposure

  • Secretome analysis: Assess whether MPN_358 is secreted or membrane-associated

When designing infection experiments, consider the following structure:

Experimental SystemParameters to MeasureTime PointsAnalysis Method
Human bronchial epithelial cellsAdherence, invasion, cytotoxicity2h, 4h, 24hImmunofluorescence, CFU counting
Mouse modelLung colonization, inflammatory responseDays 1, 3, 7, 14Histopathology, qPCR, ELISA
Cytokine profilingIL-6, TNF-α, IL-1β, IL-86h, 12h, 24hMultiplex cytokine assay
Transcriptional responseHost gene expression changes2h, 8h, 24hRNA-seq, pathway analysis

How can contradictory findings regarding MPN_358's function be reconciled through rigorous experimental design?

When studying uncharacterized proteins like MPN_358, researchers may encounter conflicting results across different experimental systems or laboratories.

Methodological approach for resolving contradictions:

  • Standardize experimental conditions: Ensure consistent protein preparations, cell lines, and assay conditions

  • Multi-method validation: Confirm findings using orthogonal techniques

  • Collaboration and replication: Establish inter-laboratory validation studies

  • Meta-analysis: Systematically review all available data to identify patterns

  • Context-dependent function: Investigate whether conflicting results stem from different physiological contexts

For example, if contradictory results emerge regarding MPN_358's subcellular localization, researchers should:

Localization MethodAdvantagesLimitationsControls Needed
ImmunofluorescenceIn situ visualizationAntibody specificity issuesPre-immune serum, knockout strain
Cell fractionationBiochemical validationPotential contaminationMultiple fractionation methods
GFP fusionLive-cell imagingTag interferenceMultiple tag positions, functional validation
Mass spectrometryUnbiased approachSample preparation biasesMultiple extraction methods

What computational strategies can predict MPN_358's function when experimental data is limited?

For uncharacterized proteins like MPN_358, computational approaches can provide critical insights to guide experimental design.

Methodological approach for computational prediction:

  • Sequence-based analysis: Employ PSI-BLAST, HHpred, and HMMER to identify distant homologs

  • Structural prediction: Use AlphaFold2 to generate structural models and identify structural homologs

  • Functional domain prediction: Apply InterProScan and SMART to identify conserved domains

  • Molecular docking: Predict potential ligands or interaction partners

  • Genomic context analysis: Examine operonic structure and gene neighborhood

A systematic computational workflow might include:

Computational ApproachToolsExpected InsightsValidation Method
Homology detectionHHpred, PSI-BLASTPotential functional homologsExperimental testing of predicted activities
Structural predictionAlphaFold2, I-TASSERFold classification, binding sitesCircular dichroism, limited proteolysis
Network analysisSTRING, GeneMANIAFunctional associationsCo-immunoprecipitation
Evolutionary analysisConSurf, Rate4SiteConserved residuesSite-directed mutagenesis

How can multi-omics approaches be leveraged to understand MPN_358's role in Mycoplasma pneumoniae biology?

Understanding an uncharacterized protein requires integrating multiple types of -omics data to build a comprehensive functional profile.

Methodological approach for multi-omics integration:

  • Transcriptomics: Analyze co-expression patterns of MPN_358 with known genes

  • Proteomics: Identify post-translational modifications and interaction partners

  • Metabolomics: Detect metabolic changes in MPN_358 mutants

  • Phenomics: Assess growth, morphology, and stress response phenotypes

  • Systems biology modeling: Integrate data into predictive network models

A comprehensive multi-omics experimental design would include:

Omics LayerTechniqueSample ComparisonIntegration Method
TranscriptomicsRNA-seqWT vs. knockout, different growth conditionsCo-expression network analysis
ProteomicsLC-MS/MSPulldown vs. control, temporal dynamicsProtein-protein interaction networks
MetabolomicsUntargeted metabolomicsWT vs. knockoutPathway enrichment analysis
PhenomicsHigh-content screeningGrowth, morphology under stressClustering analysis

What are the most rigorous approaches for validating hypothesized functions of MPN_358?

Validation is critical when studying uncharacterized proteins to avoid propagating incorrect functional annotations.

Methodological approach for function validation:

  • Complementation studies: Restore function in knockout strains with wild-type and mutant variants

  • Biochemical assays: Directly test predicted enzymatic activities with purified protein

  • Site-directed mutagenesis: Mutate predicted functional residues to confirm importance

  • Heterologous expression: Express in different bacterial species to assess function conservation

  • In vivo relevance: Determine phenotypic consequences in infection models

A validation framework should include:

Validation ApproachExperimental DesignSuccess CriteriaAlternative Explanations
ComplementationKnockout + plasmid with WT or mutant MPN_358Restoration of phenotype with WT but not mutantPolar effects, expression levels
Biochemical validationPurified protein with predicted substratesSubstrate conversion, binding constantsNon-physiological conditions
Structure-functionMutants of predicted catalytic residuesLoss of function in specific mutantsProtein misfolding
In vivo significanceAnimal model with WT vs. mutant strainsAttenuated virulence, changed colonizationCompensatory mechanisms

What are the optimal conditions for storing and handling recombinant MPN_358 to maintain its stability and activity?

Proper storage and handling of recombinant proteins is crucial for experimental reproducibility.

Methodological approach for protein stability:

  • Buffer optimization: Test multiple buffer compositions for maximal stability

  • Storage conditions: Determine optimal temperature, concentration, and additives

  • Freeze-thaw sensitivity: Assess activity loss after multiple freeze-thaw cycles

  • Long-term stability: Monitor degradation over time under different conditions

  • Activity preservation: Identify stabilizing agents that preserve function

A systematic approach to optimization might include:

ParameterTest ConditionsEvaluation MethodExpected Outcome
Buffer compositionpH 6.0-8.0, NaCl 50-500mMThermal shift assay, DLSOptimal stability conditions
Storage temperature4°C, -20°C, -80°CActivity assay after storageRecommended storage temperature
Freeze-thaw cycles0, 1, 3, 5 cyclesSize exclusion chromatographyMaximum allowable cycles
AdditivesGlycerol, sucrose, arginineAggregation monitoringEffective stabilizing agents

What are the most sensitive analytical techniques for detecting interactions between MPN_358 and potential binding partners?

Detecting protein-protein interactions for uncharacterized proteins requires sensitive and specific methods.

Methodological approach for interaction analysis:

  • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics

  • Isothermal Titration Calorimetry (ITC): Determine binding thermodynamics

  • Microscale Thermophoresis (MST): Assess interactions in solution with minimal protein consumption

  • Biolayer Interferometry (BLI): Monitor association and dissociation rates

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Map interaction interfaces

When designing interaction studies, consider this framework:

TechniqueAdvantageSample RequirementsData OutputLimitations
SPRReal-time kineticsImmobilized protein (μg)ka, kd, KD valuesSurface effects
ITCLabel-free, in solution0.1-1 mg proteinΔH, ΔS, ΔG, KDHigh protein consumption
MSTLow sample amountnM-μM concentrationKD valuesFluorescent labeling
BLIReal-time, high-throughputImmobilized protein (μg)ka, kd, KD valuesSurface effects
HDX-MSStructural information10-100 μg proteinBinding interfaceComplex data analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.