Recombinant Mycoplasma pneumoniae Uncharacterized protein MG256 homolog (MPN_359)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
MPN_359; H91_orf258; MP477; Uncharacterized protein MG256 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_359
Target Protein Sequence
MNYSYSFKEYIERFAKKVNSIDSEYFEFSSYIERMRTVFGLLIALICFSNVLCFLFIATW FSTKGFGQHYRALIFTLFIPFVTSLLANIIFINLNRAFREYFKISSKSRSFLVICAFSSL PIVNIWLMLWWVAMIKRFTSNYAFAIFDKYNGLTSGVFIFDFADNVNFEGKLVSFDNTKD TNRDFVHFYSEAKLKRDKITLQTNPIPHERMYVNRMYYQQKLSMGANQNSPSTAFANLKR YVEHKQQKIIKIKQFILT
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN359

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant MPN_359?

E. coli is the validated expression system for recombinant MPN_359 production. For optimal expression:

  • Use a vector with an N-terminal His-tag fusion for purification purposes

  • Express the full-length protein (amino acids 1-258)

  • Optimize codon usage for E. coli if expression yields are low

The recombinant protein is typically produced as a lyophilized powder after purification . Alternative expression systems like Pichia pastoris could potentially be used based on general recombinant protein production strategies, but would require optimization of metabolic parameters and NADPH levels to enhance protein yield .

What are the recommended storage and handling protocols for recombinant MPN_359?

The following protocol is recommended for optimal storage and handling:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot for long-term storage at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as they negatively impact protein stability

  • Store working aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 as a storage buffer

What are the typical applications for recombinant MPN_359 in research?

  • Surface protein characterization studies using biotinylation techniques

  • Protein cleavage analysis to identify endoproteolytic processing sites

  • Host-pathogen interaction studies, particularly with matrix molecules like heparin, actin, fibronectin, plasminogen, and fetuin

  • Structural biology investigations to determine three-dimensional structure

  • Functional studies to elucidate its role in M. pneumoniae biology

How can endoproteolytic processing of MPN_359 be investigated?

MPN_359 is likely subject to endoproteolytic processing as research shows that 134 out of 160 surface proteins in M. pneumoniae undergo such modifications . A comprehensive approach to investigating this processing includes:

  • N-terminomics analysis:

    • Use dimethyl labeling to identify neo-N-termini

    • Map cleavage sites using mass spectrometry

    • Analyze semi-tryptic peptides as indicators of proteolytic events

  • Surface accessibility verification:

    • Employ biotinylation methods to confirm surface exposure of protein fragments

    • Use affinity chromatography with different host matrix molecules to isolate processed fragments

  • Cleavage site prediction:

    • Analyze tryptic-like sites in the protein sequence

    • Look for sites with negatively charged residues (D and E) in P1' and lysine or serine/alanine in P2' and P3' positions

This approach has successfully identified multiple proteoforms of surface proteins in M. pneumoniae, showing that proteolytic processing occurs on the cell surface and likely has significant implications for host-pathogen interactions.

What methods are effective for functional characterization of uncharacterized proteins like MPN_359?

A multi-faceted approach is recommended for functional characterization:

  • Computational predictions:

    • Employ sequence homology analysis to identify functional domains

    • Use machine learning methods like Random Forest approaches (similar to RanSEPs) to predict function

    • Apply genome-scale metabolic modeling to predict functional roles

  • Experimental approaches:

    • Transposon mutagenesis methods like ProTInSeq for protein detection and functional studies

    • High-throughput protein-protein interaction screenings

    • Differential expression analysis under various conditions

  • Structural analysis:

    • X-ray crystallography or cryo-EM for 3D structure determination

    • NMR spectroscopy for dynamic structural information

    • Predictive structural modeling if experimental structures are unavailable

Combining these approaches provides complementary data streams that can help elucidate the function of previously uncharacterized proteins.

What experimental designs are recommended for studying surface exposure of MPN_359?

Based on successful approaches with M. pneumoniae surface proteins:

  • Cell surface biotinylation:

    • Treat intact cells with membrane-impermeable biotin reagents

    • Isolate biotinylated proteins using streptavidin affinity purification

    • Identify labeled proteins and peptides by mass spectrometry

  • Protease shaving:

    • Treat intact cells with proteases that cannot penetrate the membrane

    • Analyze the released peptides by mass spectrometry

    • Compare to control samples to identify surface-exposed regions

  • Immunological approaches:

    • Develop antibodies against predicted surface-exposed regions

    • Perform immunofluorescence microscopy on non-permeabilized cells

    • Use FACS analysis to quantify surface exposure

Research has shown that multiple proteoforms of surface proteins, including those derived from proteolytic processing, can be identified using these methods .

How can transposon sequencing approaches be applied to study MPN_359?

Transposon sequencing offers powerful approaches for functional genomics studies of MPN_359:

  • ProTInSeq methodology:

    • Engineer mini-transposons for insertion into the MPN_359 gene

    • Generate a transposon sequencing library

    • Select for in-frame insertions to explore protein domains

    • Use ultra-deep sequencing to determine protein abundance and detect modifications

  • Domain mapping:

    • Analyze insertion patterns to identify essential and non-essential regions

    • Map functional domains based on differential tolerability to insertions

    • Identify N-terminal and C-terminal regions with distinct functions

  • Transmembrane topology exploration:

    • Use insertion coverage patterns to predict membrane topology

    • Identify cytoplasmic and extracellular domains

    • Map functional and structural domains within the protein

This approach has been successfully applied to minimal genome bacteria such as M. pneumoniae and provides valuable insights into protein function, abundance, and topology.

How can recombinant expression of MPN_359 be optimized using metabolic engineering approaches?

Metabolic engineering can significantly improve recombinant protein expression:

  • Genome-scale metabolic modeling:

    • Use Flux Scanning based on Enforced Objective Function (FSEOF) to identify gene overexpression targets

    • Apply Minimization of Metabolic Adjustment (MOMA) to identify beneficial gene knockouts

    • Focus on pentose phosphate pathway and TCA cycle modifications

  • NADPH management:

    • Monitor and optimize NADPH levels, as protein production requires anabolic reductive power

    • Consider that production of recombinant proteins leads to an increase in the total NADP/H pool

    • Aim for increased anabolic reduction charge (approximately threefold increase is beneficial)

  • Flux optimization:

    • Increase flux through the TCA cycle (aim for ~29% increase)

    • Decrease flux through fermentative pathways

    • Slightly increase flux through the pentose phosphate pathway

These strategies have demonstrated success in enhancing recombinant protein production by up to 40% in yeast systems and could be adapted for MPN_359 expression.

What post-translational modifications should be considered when working with MPN_359?

Several key post-translational modifications should be investigated:

Modification TypeAnalysis MethodRelevance to MPN_359
Proteolytic processingN-terminomics, MS/MS analysisMajor endoproteolytic sites may generate functional protein fragments
Surface biotinylationBiotin labeling, affinity purificationCan identify surface-accessible regions and proteoforms
Lipid modificationsLipidomics, MS/MS with specific extractionMay affect membrane association and localization
GlycosylationGlycoproteomic analysisMay impact host-pathogen interactions
PhosphorylationPhosphoproteomicsMay regulate protein function

M. pneumoniae employs extensive proteolytic processing as a post-translational regulation mechanism, with cleavage occurring at specific sites including tryptic-like sites and regions with negatively charged residues in P1' positions .

What are the challenges in determining the subcellular localization of MPN_359?

Determining subcellular localization faces several challenges:

  • Technical limitations:

    • M. pneumoniae lacks a cell wall, complicating traditional fractionation procedures

    • Small cell size makes microscopy challenging

    • Limited availability of specific antibodies for immunolocalization

  • Methodological considerations:

    • Need for complementary approaches (biotinylation, protease shaving, immunofluorescence)

    • Requirement for careful controls to distinguish surface from internal proteins

    • Consideration of protein processing events that may affect localization

  • Analysis of results:

    • 58% of surface proteins in M. pneumoniae lack signal peptides but have canonical intracellular functions

    • Need to differentiate between primary localization and moonlighting functions

    • Accounting for dynamic localization changes under different conditions

Research has shown that many proteins in M. pneumoniae have dual localization patterns, being present both intracellularly and on the cell surface, requiring careful experimental design to accurately determine the localization profile of MPN_359.

How can MPN_359 research contribute to systems biology understanding of minimal genome organisms?

MPN_359 research can provide valuable insights into minimal genome organisms:

  • Functional assignment in minimal genomes:

    • Understanding the function of uncharacterized proteins like MPN_359 helps complete the functional annotation of minimal genomes

    • Contributes to defining the minimal set of genes required for cellular life

    • Helps identify proteins with multiple functions (moonlighting proteins)

  • Alternative transcriptional regulation:

    • Investigation of how MPN_359 expression is regulated in genome-reduced bacteria

    • Analysis of promoter structures, transcription initiation, and termination mechanisms

    • Identification of potential riboswitches, small RNAs, and post-transcriptional regulation

  • Protein interaction networks:

    • Mapping interactions between MPN_359 and other proteins

    • Understanding the integration of MPN_359 in cellular processes

    • Identifying potential functional complexes involving MPN_359

M. pneumoniae has been a model organism for systems biology research and detailed molecular structural analysis , making MPN_359 characterization valuable for completing our understanding of this model system.

What experimental approaches can determine if MPN_359 plays a role in host-pathogen interactions?

Several experimental approaches can assess the role of MPN_359 in host-pathogen interactions:

  • Adhesion assays:

    • Express recombinant fragments of MPN_359 and test binding to host molecules

    • Use affinity chromatography with host matrix molecules (heparin, actin, fibronectin, plasminogen, fetuin)

    • Assess binding to surface proteins of model host epithelial cells (e.g., A594 cells)

  • Deletion/knockdown studies:

    • Generate MPN_359 deletion mutants using CRISPR-Cas or transposon approaches

    • Assess effects on adhesion, invasion, and persistence in cell culture models

    • Evaluate changes in host immune responses

  • Structural-functional analysis:

    • Map functional domains through fragment expression and binding assays

    • Identify potential adhesive binding domains

    • Analyze the effects of proteolytic processing on binding activity

Research has shown that proteolytic processing of surface proteins in M. pneumoniae likely has profound implications for how the host immune system recognizes and responds to the pathogen .

What bioinformatic tools are most suitable for predicting MPN_359 function?

Several bioinformatic approaches are recommended:

  • Machine learning methods:

    • Random forest approaches similar to RanSEPs for functional prediction

    • Neural network-based function prediction from sequence data

    • Support vector machines for classification of protein function

  • Comparative genomics:

    • Identify homologs in related species

    • Analyze genomic context and conserved gene neighborhoods

    • Examine evolutionary patterns and selection pressure

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Identification of structural motifs associated with known functions

    • Molecular docking to predict potential binding partners

  • Integrative approaches:

    • Combine multiple prediction methods for consensus functional annotation

    • Integrate diverse data sources (sequence, structure, expression, interaction)

    • Apply Bayesian networks to assign confidence scores to predictions

These computational approaches complement experimental methods and can provide valuable insights into potential functions of uncharacterized proteins like MPN_359.

What are the major challenges in purifying functionally active MPN_359?

Several challenges exist in purifying functionally active MPN_359:

  • Expression optimization:

    • Challenge: Low expression levels or inclusion body formation

    • Solution: Optimize codon usage, use solubility-enhancing tags, and test different E. coli strains

  • Protein stability:

    • Challenge: Maintaining structural integrity during purification

    • Solution: Add 6% Trehalose to storage buffer, maintain pH at 8.0, and avoid repeated freeze-thaw cycles

  • Functional conformation:

    • Challenge: Ensuring proper folding for functional studies

    • Solution: Test various refolding protocols if expressed in inclusion bodies

  • Post-translational modifications:

    • Challenge: Recombinant systems may not reproduce native modifications

    • Solution: Consider eukaryotic expression systems for specific modifications

  • Proteolytic degradation:

    • Challenge: Unwanted proteolysis during expression/purification

    • Solution: Use protease inhibitors and optimize purification conditions to minimize processing

For optimal reconstitution, the lyophilized protein should be briefly centrifuged before opening and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for stability .

How can researchers differentiate between specific and non-specific interactions of MPN_359 with host molecules?

Differentiating specific from non-specific interactions requires careful controls:

  • Competition assays:

    • Challenge MPN_359-host interactions with excess unlabeled protein

    • Specific interactions will show dose-dependent inhibition

    • Non-specific binding will be minimally affected

  • Domain mapping:

    • Express different fragments of MPN_359

    • Specific interactions will map to defined functional domains

    • Non-specific interactions will occur across multiple regions

  • Mutational analysis:

    • Introduce point mutations at predicted binding sites

    • Specific interactions will be disrupted by targeted mutations

    • Non-specific interactions will be minimally affected

  • Cross-linking studies:

    • Use chemical cross-linking followed by mass spectrometry

    • Identify specific binding interfaces

    • Distinguish from random proximity interactions

Research has shown that affinity chromatography with different host matrix molecules is effective at isolating specific binding fragments and mapping functionally-important adhesive domains in M. pneumoniae proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.