Recombinant Mycoplasma pneumoniae Uncharacterized protein MG267 homolog (MPN_385)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance for dry ice shipping; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_385; F11_orf114; MP452; Uncharacterized protein MG267 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_385
Target Protein Sequence
MLLKRLIKLAIFLFFVAVGFIIFIGSFWLNTYNTKEWANLLAEKDASGLIVQIIPNINQW FKGTVEQQQKLFQTLVHFFIPVGFGLLFGIAVAIIADLFYHLIKYLIKRSFKKN
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN385

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the uncharacterized protein MG267 homolog (MPN_385) in Mycoplasma pneumoniae?

MPN_385 is classified as an uncharacterized protein in Mycoplasma pneumoniae, which means its precise function has not been experimentally validated. Like many uncharacterized proteins, it was identified through genome sequencing efforts but lacks functional annotation. Genomic analyses suggest it may be a homolog of the MG267 protein, potentially sharing structural or functional similarities. This homology provides initial clues for investigation, but experimental validation remains necessary to confirm its specific biological role in M. pneumoniae .

When approaching uncharacterized proteins like MPN_385, researchers typically begin with bioinformatic analysis to identify conserved domains, structural motifs, or sequence similarities to characterized proteins. An atlas-based approach similar to the one described for co-essential pathways can potentially assign preliminary function to MPN_385 through its associations with better-characterized genes or modules .

How can I identify the potential function of MPN_385 using bioinformatic approaches?

To identify the potential function of MPN_385 using bioinformatics, researchers should employ a multi-layered approach:

  • Sequence Alignment Analysis: Compare the amino acid sequence of MPN_385 with other proteins using tools like BLAST and perform multiple sequence alignments with potential homologs from related organisms. This approach helped identify conserved regions in M. pneumoniae proteins such as the P30 adhesin, where sequence identity ranges from 97% to 100% among different isolates .

  • Structural Prediction: Utilize servers like SWISS-MODEL to predict the tertiary structure of MPN_385 based on homologous proteins with known structures. This approach was successfully used for M. pneumoniae P30 protein and Porcine orthorubulavirus proteins, providing insights into protein function .

  • Co-essentiality Analysis: Examine gene dependency patterns across multiple experimental conditions to identify genes that cluster with MPN_385, suggesting functional relationships. This method has successfully predicted functions for 108 previously uncharacterized genes in various organisms .

  • Motif and Domain Analysis: Search for conserved motifs or domains that might indicate function, such as transmembrane regions, binding sites, or enzymatic active sites using algorithms like those described by Kyte-Doolittle, Jameson-Wolf, and Kolaskar-Tongaonkar .

The integration of these methods increases the reliability of functional predictions and guides subsequent experimental validation.

What are the basic steps for cloning and expressing recombinant MPN_385?

The basic steps for cloning and expressing recombinant MPN_385 follow a standardized protocol, which can be adapted from successful approaches used for other Mycoplasma proteins:

  • Gene Amplification: Amplify the open reading frame (ORF) of MPN_385 using PCR with specific primers designed from the genome sequence of M. pneumoniae .

  • Vector Selection and Cloning: Clone the amplified gene into an appropriate expression vector. For enhanced protein solubility, consider using a vector system like pET-SUMO that incorporates solubility-enhancing tags. The one-step cloning approach utilizing Taq polymerase-generated A' overhangs can facilitate efficient insertion into the vector .

  • Transformation and Verification: Transform the recombinant plasmid into a suitable E. coli strain for expression. Verify correct insertion and orientation through PCR and sequencing analysis .

  • Expression Optimization: Induce protein expression using IPTG or other appropriate inducers. Optimize expression conditions (temperature, inducer concentration, duration) to maximize yield while maintaining protein quality .

  • Protein Purification: Extract the protein from bacterial cells and purify using affinity chromatography, typically with Ni-NTA resin if a His-tag was incorporated. For proteins that form inclusion bodies (as often occurs), solubilization steps using agents like sarcosyl may be necessary .

These steps yielded approximately 150 μg/mL of purified protein from 100 mL of culture for other recombinant proteins, providing a benchmark for expected yields .

How can I determine the structural characteristics of recombinant MPN_385?

Determining the structural characteristics of recombinant MPN_385 requires a comprehensive approach combining computational predictions with experimental validation:

The combination of these approaches creates a comprehensive structural profile that can inform functional hypotheses and guide site-directed mutagenesis experiments to probe structure-function relationships .

What experimental design approaches are most effective for determining MPN_385's role in Mycoplasma pneumoniae pathogenesis?

To determine MPN_385's role in M. pneumoniae pathogenesis, a systematic experimental design approach should be implemented:

  • Gene Knockout/Knockdown Studies: Generate MPN_385 deletion mutants or knockdown strains using CRISPR-Cas or similar genetic engineering techniques. Compare phenotypes with wild-type strains to identify changes in virulence, adhesion properties, or other pathogenicity measures. Similar approaches were instrumental in determining that M. pneumoniae mutants lacking the P30 adhesin gene became nonadhesive and demonstrated altered pathogenicity .

  • Protein-Protein Interaction Analysis: Identify interaction partners using techniques like co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling methods such as BioID. Analysis of interaction networks can place MPN_385 in specific pathogenic pathways .

  • Adhesion and Invasion Assays: Evaluate the role of MPN_385 in bacterial adhesion to host respiratory epithelial cells using protocols similar to those established for P30 protein studies. These should include:

    • Adhesion assays with wild-type and MPN_385-deficient bacteria

    • Inhibition assays using anti-MPN_385 antibodies

    • Comparison studies with cells where potential receptor proteins are knocked down or overexpressed

  • Cell Culture Models: Use bronchial epithelial cell lines like BEAS-2B (as employed in P30 studies) to assess the effect of MPN_385 on host cell responses, including cytokine production, apoptosis, and inflammatory pathway activation .

  • Animal Infection Models: Confirm in vitro findings using appropriate animal models, monitoring colonization efficiency, tissue damage, and immune responses when comparing wild-type and MPN_385-modified strains .

Each experiment should include appropriate controls and sufficient biological replicates to ensure statistical power, with careful attention to avoiding questionable research practices as highlighted in experimental design guidelines .

How can advanced co-essentiality profiling be applied to understand MPN_385's function in the M. pneumoniae genome?

Advanced co-essentiality profiling represents a powerful approach to uncover MPN_385's function by analyzing patterns of gene dependency across multiple conditions:

  • Comprehensive Gene Dependency Screening: Generate dependency profiles for MPN_385 across diverse conditions by measuring the effects of its depletion on cellular fitness. This approach has successfully identified functional modules for previously uncharacterized genes .

  • Statistical Refinement Methods: Apply robust statistical methods to filter out false positives common in co-essentiality data. This critical step enables the reliable identification of true functional relationships between genes .

  • Module Construction and Analysis: Group genes with similar dependency profiles into functional modules. Genes within the same module typically participate in related biological processes, providing context for MPN_385's function .

  • Cross-referencing with Known Pathways: Compare the co-essential module containing MPN_385 with established protein complexes and pathways to identify potential functional associations. This approach has successfully recapitulated diverse pathways and protein complexes in previous studies .

  • Validation of Top Predictions: Design targeted experiments to validate the top functional predictions generated by co-essentiality analysis. These experiments should focus on the specific biological processes suggested by the module analysis .

The power of this approach lies in its genome-wide perspective, which can reveal unexpected functional relationships not apparent from sequence analysis alone. For instance, similar co-essentiality profiling has successfully assigned functions to 108 previously uncharacterized genes in other organisms, demonstrating the method's effectiveness .

How can I develop and validate an ELISA assay using recombinant MPN_385 for serological studies?

Developing a reliable ELISA assay using recombinant MPN_385 requires systematic optimization and validation:

  • Recombinant Protein Preparation: Express and purify MPN_385 using the pET-SUMO expression system or similar vectors that enable high-yield, high-purity protein production. Ensure protein quality through SDS-PAGE and Western blot analysis before proceeding to assay development .

  • ELISA Protocol Development:

    • Optimize coating concentration (starting with approximately 100 ng of purified protein per well)

    • Determine optimal blocking conditions to minimize background signal

    • Establish appropriate serum dilutions (1:150 is a common starting point)

    • Select and titrate secondary antibody conjugates (typically 1:5000 dilution for anti-IgG-HRP)

  • Assay Validation Steps:

    • Analytical sensitivity: Determine the lowest detectable antibody concentration

    • Analytical specificity: Test for cross-reactivity with antibodies against other Mycoplasma proteins

    • Diagnostic sensitivity and specificity: Calculate using panels of confirmed positive and negative sera

    • Reproducibility: Assess intra-assay and inter-assay coefficients of variation (CV values below 15% are generally acceptable)

  • Performance Evaluation:

    • Test the assay's ability to detect seroconversion at various time points post-infection or immunization

    • Evaluate antibody persistence over time

    • Compare performance with established serological tests for M. pneumoniae

  • Statistical Analysis: Apply appropriate statistical methods such as two-way ANOVA to analyze results, with significance thresholds set at p < 0.05 and 95% confidence intervals. Present data as means ± Standard Error of Mean (SEM) .

This methodical approach has proven successful for other M. pneumoniae proteins like P30, where recombinant protein-based ELISAs demonstrated high specificity and sensitivity in detecting antibodies from early infection stages through persistence .

What approaches can be used to evaluate MPN_385's potential as a vaccine candidate or diagnostic marker?

Evaluating MPN_385's potential as a vaccine candidate or diagnostic marker requires a comprehensive assessment approach:

  • Immunogenicity Analysis:

    • Express recombinant MPN_385 in E. coli using optimized expression systems like pET-SUMO

    • Immunize experimental animals (mice or rabbits) with purified protein formulated with appropriate adjuvants

    • Monitor antibody response using indirect ELISA, comparing protein-plus-adjuvant groups with protein-alone controls

    • Analyze antibody titers and persistence over time (7-28 days post-immunization is typically assessed)

  • Epitope Mapping and Optimization:

    • Identify immunodominant epitopes using computational prediction algorithms (Jameson-Wolf, Kolaskar-Tongaonkar)

    • Confirm predictions through experimental methods such as peptide arrays or phage display

    • Consider creating optimized fusion proteins combining epitopes from MPN_385 with other immunogenic proteins, similar to the successful P1-P30 fusion approach

  • Protective Efficacy Assessment:

    • Challenge immunized animals with virulent M. pneumoniae strains

    • Evaluate bacterial load in respiratory tissues

    • Monitor for disease symptoms and complications

    • Assess immune response profiles, being particularly vigilant for potential Th17-mediated autoimmune responses that have complicated previous vaccine candidates

  • Diagnostic Marker Evaluation:

    • Test MPN_385's reactivity with serum samples from confirmed M. pneumoniae-infected patients

    • Compare sensitivity and specificity with established diagnostic antigens

    • Consider combinatorial approaches using multiple antigens (similar to P1, P30, and P116 combinations) for improved diagnostic performance

  • Safety Profiles:

    • Evaluate potential cross-reactivity with human proteins

    • Assess adjuvant combinations for optimal safety and efficacy (chitosan has shown promise as a mucosal adjuvant for Mycoplasma proteins)

The success of fusion protein approaches in previous studies suggests that combining MPN_385 with established immunogenic proteins might enhance both vaccine efficacy and diagnostic performance .

What are the common challenges in expressing soluble recombinant MPN_385 and how can they be addressed?

Expressing soluble recombinant MPN_385 likely presents several challenges common to Mycoplasma proteins. Here are potential issues and evidence-based solutions:

  • Inclusion Body Formation:

    • Challenge: Many recombinant proteins form insoluble inclusion bodies, as observed with other M. pneumoniae proteins .

    • Solutions:

      • Utilize solubility-enhancing fusion tags like SUMO

      • Optimize expression conditions (lower temperature, reduced inducer concentration)

      • If inclusion bodies persist, implement solubilization strategies using sarcosyl buffer solution followed by refolding procedures

  • Codon Usage Bias:

    • Challenge: Differences in codon usage between Mycoplasma and E. coli can reduce expression efficiency.

    • Solutions:

      • Synthesize codon-optimized gene sequences

      • Express in E. coli strains containing rare tRNAs (Rosetta, CodonPlus)

      • Consider baculovirus or mammalian expression systems for complex proteins

  • Protein Toxicity to Host Cells:

    • Challenge: Some recombinant proteins may be toxic to bacterial host cells.

    • Solutions:

      • Use tightly regulated expression systems

      • Employ specialized E. coli strains designed for toxic protein expression

      • Optimize induction timing and harvest cells before significant growth inhibition occurs

  • Protein Instability:

    • Challenge: Some proteins degrade rapidly during expression or purification.

    • Solutions:

      • Add protease inhibitors during purification

      • Incorporate stabilizing buffers with appropriate pH and salt concentrations

      • Optimize purification temperature (typically 4°C)

      • Consider on-column refolding during affinity purification

  • Purification Challenges:

    • Challenge: Poor binding to affinity resins or co-purification of contaminants.

    • Solutions:

      • Optimize imidazole concentrations in binding, washing, and elution buffers

      • Implement multi-step purification strategies (ion exchange, size exclusion)

      • Consider alternative affinity tags if His-tag accessibility is compromised

A systematic approach, similar to that used for nucleoprotein and matrix protein expression, can yield approximately 150 μg/mL of purified protein from 100 mL of bacterial culture, providing a benchmark for expected yields of correctly expressed MPN_385 .

How can I design experiments to resolve contradictory data regarding MPN_385's function?

Resolving contradictory data regarding MPN_385's function requires a systematic approach to experimental design and data analysis:

  • Root Cause Analysis of Contradictions:

    • Critically evaluate methodological differences between studies (expression systems, purification methods, assay conditions)

    • Assess potential strain-specific variations in MPN_385 sequence or expression

    • Consider technical factors such as protein tagging methods or buffer conditions that might affect function

  • Standardized Experimental Design:

    • Implement experiments with appropriate statistical power based on power analysis

    • Include both positive and negative controls in all experiments

    • Ensure biological replicates (minimum n=3) and technical replicates to distinguish random variation from true effects

  • Orthogonal Validation Approaches:

    • Employ multiple, methodologically distinct techniques to test the same hypothesis

    • For example, if protein-protein interactions show contradictory results, validate using several methods:

      • Co-immunoprecipitation

      • Surface plasmon resonance (SPR)

      • Proximity ligation assays (PLA)

      • Fluorescence resonance energy transfer (FRET)

  • In Vivo/In Vitro Correlation Studies:

    • Test whether contradictory in vitro findings are reproduced in relevant in vivo models

    • Design experiments that bridge the gap between artificial systems and natural biological contexts

  • Transparent Data Reporting:

    • Document all experimental conditions comprehensively

    • Report negative or contradictory results alongside positive findings

    • Implement open research practices to increase transparency and reproducibility

  • Collaborative Validation:

    • Engage independent laboratories to replicate key experiments under standardized conditions

    • Share materials, protocols, and data to facilitate reproducibility

By avoiding questionable research practices and emphasizing experimental rigor, researchers can resolve contradictions and establish a consistent understanding of MPN_385's function .

What advanced structural biology techniques can provide insights into MPN_385's mechanism of action?

To elucidate MPN_385's mechanism of action, researchers can employ these advanced structural biology techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of protein structure in near-native conditions without crystallization

    • Particularly valuable for membrane-associated proteins or large complexes

    • Can reveal structural transitions relevant to function

    • Resolution has improved to near-atomic levels (2-3Å) for many proteins

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein dynamics and conformational changes upon binding to partners

    • Identifies regions involved in interactions without requiring crystallization

    • Provides insights into allosteric mechanisms

    • Complements static structural techniques with dynamic information

  • Integrative Structural Biology Approaches:

    • Combines multiple experimental techniques (X-ray crystallography, NMR, SAXS, Cryo-EM)

    • Creates comprehensive structural models that capture different aspects of protein function

    • Particularly valuable when individual techniques have limitations for specific protein regions

    • Computational integration methods like IMP (Integrative Modeling Platform) enable synthesis of diverse data types

  • Single-Molecule Techniques:

    • Single-molecule FRET monitors conformational changes in real-time

    • Optical tweezers or atomic force microscopy measure mechanical properties

    • Reveals heterogeneity in protein behavior not detectable in ensemble measurements

    • Particularly valuable for proteins with multiple functional states

  • Time-Resolved Structural Methods:

    • Time-resolved crystallography captures structural snapshots during reactions

    • Serial femtosecond crystallography using X-ray free-electron lasers (XFELs) achieves ultra-high time resolution

    • Enables visualization of transient states in enzyme catalysis or conformational changes

  • Surface-Enhanced Raman Spectroscopy (SERS):

    • Provides fingerprint-like spectroscopic data for protein characterization

    • Can distinguish between different genotypes or phenotypes of Mycoplasma pneumoniae strains

    • Could enable rapid and accurate clinical testing applications for MPN_385-based diagnostics

These advanced methods can reveal not just the static structure of MPN_385 but also its dynamic behavior during interactions with binding partners or conformational changes associated with its function .

How should I analyze and interpret large-scale data sets generated from MPN_385 functional studies?

Analyzing large-scale data sets from MPN_385 functional studies requires rigorous methodological approaches:

  • Quality Control and Preprocessing:

    • Apply stringent quality filters to raw data

    • Normalize data appropriately to account for technical variations

    • Identify and handle outliers through statistically sound methods

    • Document all preprocessing steps for reproducibility

  • Statistical Analysis Framework:

    • Select appropriate statistical tests based on data distribution and experimental design

    • Apply multiple testing corrections for high-dimensional data (e.g., Benjamini-Hochberg for false discovery rate control)

    • Report effect sizes alongside p-values to indicate biological significance

    • Use statistical approaches like two-way ANOVA for complex designs with 95% confidence intervals (p < 0.05 significance threshold)

  • Functional Enrichment Analysis:

    • Map MPN_385-associated genes or proteins to biological pathways

    • Identify significantly enriched functional categories using tools like Gene Ontology

    • Apply methods similar to those used in co-essentiality profiling that successfully identified functions for previously uncharacterized genes

  • Network-Based Interpretation:

    • Construct interaction networks from protein-protein interaction data

    • Identify modules or communities within networks that suggest functional associations

    • Compare MPN_385's network position with well-characterized proteins to infer function

    • Apply atlas-building approaches similar to those used for co-essential modules

  • Integration of Multi-omics Data:

    • Combine proteomics, transcriptomics, and phenotypic data for comprehensive analysis

    • Apply integrative statistical models to identify consistent patterns across data types

    • Weigh evidence from different experimental approaches based on reliability and relevance

  • Visualization Strategies:

    • Develop clear, informative visualizations that accurately represent complex data relationships

    • Avoid visualization methods that could mislead interpretation

    • Present data in formats accessible to both specialists and general scientific audiences

Data should be presented as means ± Standard Error of Mean (SEM) with appropriate significance indicators (* p < 0.05; ** p < 0.005; *** p < 0.0005) when statistical comparisons are made .

What bioinformatic tools are most effective for predicting interactions between MPN_385 and host proteins?

For predicting MPN_385-host protein interactions, several bioinformatic approaches have proven effective:

  • Sequence-Based Prediction Methods:

    • Interolog Mapping: Uses known interactions between homologous proteins to predict new interactions. Particularly useful when MPN_385 has homologs in other organisms with better-characterized interactomes.

    • Domain-Based Approaches: Identifies conserved domain pairs that frequently mediate protein-protein interactions. Similar to approaches used for characterizing P30 protein domains and their interactions .

    • Motif-Based Prediction: Detects short linear motifs in MPN_385 that might interact with domains in host proteins. These methods have been useful for predicting functional regions in other M. pneumoniae proteins .

  • Structure-Based Prediction Methods:

    • Protein-Protein Docking: Uses predicted or experimental structures to model physical interactions through tools like HADDOCK, ZDOCK, or ClusPro.

    • Template-Based Modeling: Leverages structural similarities to proteins with known interaction partners, similar to approaches used for Mycoplasma protein structure prediction using templates from related organisms .

    • Molecular Dynamics Simulations: Evaluates the stability and energetics of predicted interactions, providing insights into binding mechanisms and specificity.

  • Network and Co-evolution-Based Methods:

    • Phylogenetic Profiling: Identifies proteins with similar evolutionary histories, suggesting functional relationships.

    • Direct Coupling Analysis: Detects co-evolving residues between proteins, indicating potential interaction interfaces.

    • Network-Based Inference: Uses graph theory to predict new interactions based on network topology of known interactions .

  • Machine Learning Approaches:

    • Support Vector Machines and Random Forests: Integrates multiple features to classify potential interactions.

    • Deep Learning Models: Leverages neural networks to identify complex patterns in interaction data.

    • Transfer Learning: Applies knowledge from well-studied host-pathogen systems to M. pneumoniae-specific predictions.

  • Experimental Validation Planning:

    • Design targeted experiments to verify top predictions, similar to the validation approaches used for co-essential modules .

    • Prioritize interactions based on confidence scores and biological relevance.

    • Consider approaches like the Virus Overlay Protein Binding Assay (VOPBA) and Liquid Chromatography-Mass Spectrometry (LC-MS) that have been successfully applied to screen for specific interaction proteins binding to bronchial epithelial cells .

The combination of these approaches, followed by experimental validation, provides the most reliable prediction of MPN_385's interaction with host proteins.

How can I establish a collaborative research network to comprehensively characterize MPN_385?

Establishing a collaborative research network for comprehensive MPN_385 characterization requires strategic planning and implementation:

  • Identify Complementary Expertise:

    • Map the required expertise spanning structural biology, functional genomics, proteomics, and clinical microbiology

    • Identify research groups with specialized equipment or methodologies relevant to MPN_385 characterization

    • Consider including both academic and industry partners for translational perspectives

  • Structured Collaboration Framework:

    • Establish clear research objectives and deliverables with defined timelines

    • Implement standardized protocols across participating laboratories to ensure data comparability

    • Develop material transfer agreements for sharing biological materials and reagents

    • Create a central database for data integration and sharing

  • Open Science Implementation:

    • Adopt transparency practices as emphasized in experimental design guidelines

    • Pre-register study protocols and analysis plans to enhance reproducibility

    • Utilize electronic lab notebooks for comprehensive documentation

    • Commit to data sharing policies aligned with FAIR principles (Findable, Accessible, Interoperable, Reusable)

  • Multi-disciplinary Approach:

    • Integrate diverse methodologies similar to those used in other protein characterization studies:

      • Structural biology techniques (X-ray crystallography, Cryo-EM)

      • Functional assays (adhesion, invasion, immunological responses)

      • Omics approaches (proteomics, transcriptomics)

      • Computational modeling and prediction

  • Collaborative Project Management:

    • Implement regular coordination meetings and progress updates

    • Utilize project management tools to track milestones and deliverables

    • Establish a steering committee with representatives from each participating group

    • Develop consensus decision-making processes for research direction adjustments

  • Training and Knowledge Exchange:

    • Organize workshops and training sessions for standardized methodologies

    • Facilitate researcher exchanges between laboratories

    • Create mentoring opportunities for early-career researchers

    • Develop shared resources and protocols

This collaborative approach mirrors successful research consortia that have tackled complex biological questions requiring complementary expertise and methodologies .

What are the most promising future research directions for understanding MPN_385's role in Mycoplasma pneumoniae biology?

The most promising future research directions for understanding MPN_385's role combine cutting-edge technologies with systematic functional analysis:

  • Genome-Wide Functional Screening:

    • Apply CRISPR interference or similar techniques to systematically assess genetic interactions between MPN_385 and other M. pneumoniae genes

    • Implement co-essentiality profiling approaches that have successfully characterized functions for previously uncharacterized genes

    • Develop comprehensive genetic interaction maps to position MPN_385 within cellular pathways

  • Advanced Structural Analysis:

    • Determine high-resolution structures using Cryo-EM or X-ray crystallography

    • Characterize dynamic structural changes using hydrogen-deuterium exchange mass spectrometry

    • Elucidate interaction interfaces with binding partners using cross-linking mass spectrometry

    • Apply approaches similar to those used for characterizing P30 and other M. pneumoniae proteins

  • Host-Pathogen Interaction Studies:

    • Identify host cell receptors or binding partners using proximity labeling approaches

    • Characterize the impact of MPN_385 on host cell signaling pathways

    • Develop cell culture and animal models to assess MPN_385's role in colonization and pathogenesis

    • Apply techniques similar to the Virus Overlay Protein Binding Assay (VOPBA) that has proven useful for identifying specific interaction proteins

  • Translational Applications:

    • Evaluate MPN_385's potential as a diagnostic biomarker through antibody detection in patient samples

    • Assess its utility as a vaccine component, potentially as part of multi-antigen formulations

    • Explore whether antibodies against MPN_385 could inhibit M. pneumoniae colonization, similar to findings with P1-P30 fusion proteins

  • Systems Biology Integration:

    • Develop comprehensive models incorporating transcriptomic, proteomic, and metabolomic data

    • Map MPN_385's position in the functional network of M. pneumoniae

    • Apply machine learning approaches to predict phenotypic outcomes of MPN_385 perturbation

  • Comparative Analysis Across Mycoplasma Species:

    • Identify and characterize MPN_385 homologs in related species

    • Compare functional roles to understand evolutionary conservation and divergence

    • Apply similar approaches to those used for comparing P30 and other proteins across Mycoplasma species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.