Recombinant Mycoplasma pneumoniae Uncharacterized protein MG279 homolog (MPN_398)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Target Protein Sequence
MFKFLKKLSTFLIVLIGILLVGGITAAGYFAFENREPINNYYKEGYNKVKQYNEEIKKVS KSLSSNELVKTLGDVESSIKEGKELTKLLGDSALESSFNQLEDSLSKVNNFSKGSTFTEV KNTIEKINQYVDEILKRFPNPNENDQFKEYVTNISQIVFYVGVSIIGTFVVSGALLFIFT KRVYGVRVSRFNPQRLLKKHLVLLLQKNQDVYDEVFES

Q&A

What is known about the MPN_398 protein in Mycoplasma pneumoniae?

MPN_398 represents one of many uncharacterized proteins in the Mycoplasma pneumoniae genome. While specific information about MPN_398 is limited in the literature, it belongs to a class of proteins that constitute a significant portion of the M. pneumoniae proteome. The organism's genome is relatively small but contains approximately 8% dispersed repetitive elements that play roles in generating antigenic variation through homologous recombination . Uncharacterized proteins like MPN_398 are functionally and structurally undefined and are typically classified into uncharacterized protein families or domains of unknown function . Functional annotation of such proteins is crucial for understanding pathogen biology, gene regulation mechanisms, and identifying novel targets for therapeutic intervention.

How can I determine basic physicochemical properties of MPN_398?

The characterization process should begin with in silico analysis of physicochemical parameters. Using bioinformatic tools similar to those employed in other uncharacterized protein studies, you can determine:

  • Molecular weight and theoretical pI

  • Amino acid composition

  • Extinction coefficient

  • Aliphatic index

  • Grand average of hydropathicity (GRAVY)

These parameters provide initial insights into protein behavior. For instance, the GRAVY value indicates whether the protein is likely hydrophilic or hydrophobic, which suggests potential cellular localization. Tools like ProtParam (ExPASy), PSIPRED, and TMHMM can be employed for these analyses . A comprehensive table of these parameters should be compiled as a foundation for further experimental work.

What is the predicted cellular localization of MPN_398?

Predicting cellular localization is essential for understanding a protein's functional context. For MPN_398, employ multiple prediction algorithms to achieve consensus. Tools like PSORTb, CELLO, and SignalP can predict whether the protein is likely cytoplasmic, membrane-associated, or secreted. For Mycoplasma proteins, membrane localization is particularly significant as many virulence factors are membrane-associated proteins that interact with host cells . If MPN_398 contains transmembrane domains (detectable via TMHMM or HMMTOP), it may function similar to other M. pneumoniae membrane proteins like adhesins P1, P30, or P65, which form complexes essential for cytadherence and virulence .

What expression systems are most suitable for recombinant production of MPN_398?

Selection of an appropriate expression system for MPN_398 should consider several factors:

  • Codon optimization: Mycoplasma species have different codon usage compared to common expression hosts like E. coli. Codon optimization of the MPN_398 gene sequence is recommended to enhance expression efficiency.

  • Expression vectors: For initial characterization, pET-series vectors with IPTG-inducible promoters offer controlled expression levels and fusion tag options (His, GST, MBP) to facilitate purification and potentially enhance solubility.

  • Host selection: While E. coli is the most common host, specific strains should be selected based on:

    • BL21(DE3) for general expression

    • Rosetta or CodonPlus strains if codon bias is a concern

    • Origami strains if disulfide bonds are predicted

    • ArcticExpress if low-temperature expression is needed to improve solubility

Design of Experiments (DoE) approach should be employed rather than the one-factor-at-a-time method to optimize expression conditions efficiently. This systematic approach can identify optimal combinations of temperature, inducer concentration, and induction time with fewer experiments .

How should I optimize purification protocols for recombinant MPN_398?

Purification optimization requires a methodical approach that considers protein characteristics and research objectives:

  • Initial screening: Perform small-scale expression tests with different fusion tags (His, GST, MBP) to determine which provides best solubility and yield.

  • Purification strategy optimization using DoE:

    • Define critical factors: buffer pH, salt concentration, imidazole concentration (for His-tagged proteins)

    • Design factorial experiments to determine optimal conditions

    • Analyze results using response surface methodology to identify optimal parameter combinations

  • Purification protocol refinement:

Purification StepVariables to OptimizeMeasurement Parameters
Cell lysisBuffer composition, lysis methodTotal protein yield, target protein in soluble fraction
Affinity chromatographyColumn volume, flow rate, binding/washing/elution buffersPurity, yield, specific binding
Size exclusionBuffer composition, flow rateOligomeric state, aggregation tendency, final purity
Quality controlStorage conditions, stability parametersPurity (SDS-PAGE), activity assays

DoE software packages can facilitate experimental design and analysis of results, leading to optimized conditions in a resource-efficient manner .

What strategies can determine if MPN_398 interacts with host proteins or other bacterial factors?

Several complementary approaches can identify interaction partners:

  • Computational prediction:

    • String database analysis to predict functional partners with confidence scores >1

    • Homology detection with human proteins using BLASTp against human proteome

  • Pull-down assays:

    • Express recombinant MPN_398 with affinity tag

    • Incubate with host cell lysates or M. pneumoniae extracts

    • Identify binding partners via mass spectrometry

  • Yeast two-hybrid screening:

    • Construct bait plasmid containing MPN_398

    • Screen against host or M. pneumoniae cDNA libraries

    • Validate positive interactions with secondary assays

  • Co-immunoprecipitation with targeted candidates:

    • Based on predicted functions, test specific interactions with known M. pneumoniae virulence factors like adhesins (P1, P30, P65) or immunomodulatory proteins like IbpM

  • Proximity labeling methods:

    • BioID or APEX2 fusion to label proteins in proximity to MPN_398 in living cells

    • Identifies transient or weak interactions that may be missed by other methods

Interaction data should be compiled and visualized as a network to generate hypotheses about functional roles.

What bioinformatic approaches should I use to predict the function of MPN_398?

A systematic bioinformatic workflow is essential for functional prediction:

  • Domain identification using multiple databases:

    • InterProScan, Motif search, SMART

    • HMMER profiles and NCBI Conserved Domain Architecture Retrieval Tool (CDART)

    • BlastP search against characterized proteins

  • Fold recognition and structural prediction:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Phyre2 and Swiss-Model for homology-based modeling

    • Structure-based function prediction via tools like ProFunc or COACH

  • Function prediction validation:

    • Assign functions only when conserved domains are predicted by two or more independent databases

    • Categorize predictions as high-confidence or low-confidence based on consensus

The predicted functions should be compared against known virulence factors in M. pneumoniae, particularly focusing on:

  • Adhesion-related functions (like P1, P30 adhesins)

  • Immune evasion capabilities (similar to IbpM protein)

  • Potential nuclease activity (like mpn491 that degrades neutrophil extracellular traps)

  • Antioxidant functions (similar to mpn668 that protects against oxidative stress)

How can I experimentally validate predicted functions of MPN_398?

Experimental validation requires a hypothesis-driven approach based on bioinformatic predictions:

  • Targeted enzymatic assays:

    • If predicted to have nuclease activity: Test DNA/RNA degradation capacity

    • If predicted to have oxidoreductase activity: Measure substrate conversion rates

    • Design control experiments with site-directed mutants of predicted catalytic residues

  • Localization studies:

    • Fluorescent protein fusion expression to determine subcellular localization

    • Co-localization with known cellular markers or other M. pneumoniae proteins

  • Functional complementation:

    • Express MPN_398 in appropriate knockout strains lacking genes with similar predicted functions

    • Assess rescue of phenotype to confirm functional equivalence

  • Phenotypic analysis of gene knockout/knockdown:

    • CRISPR interference or antisense RNA to reduce expression

    • Compare growth, morphology, and virulence-associated phenotypes with wild-type

  • Host interaction studies:

    • If predicted to interact with host components, perform binding assays with purified human proteins

    • Cell culture infection models to assess impact on host cell responses

Validation should include appropriate statistical analysis and controls to ensure reproducibility of findings.

How can I determine if MPN_398 is involved in M. pneumoniae virulence mechanisms?

Investigating virulence associations requires multiple lines of evidence:

  • Expression analysis during infection:

    • qRT-PCR to measure MPN_398 expression levels during different infection stages

    • RNA-seq to place MPN_398 in co-expression networks with known virulence factors

  • Immune response interaction:

    • Test if MPN_398 affects neutrophil extracellular trap (NET) formation or degradation

    • Examine interaction with host immunoglobulins (similar to IbpM)

    • Measure impact on ROS production or neutralization in host cells

  • Adhesion and invasion assays:

    • Determine if MPN_398 affects bacterial adherence to respiratory epithelial cells

    • Assess impact on intracellular invasion and persistence (an important immune evasion strategy)

  • Animal model studies:

    • Compare wild-type and MPN_398 mutant strains in appropriate animal models

    • Measure bacterial load, inflammation, and disease progression

Results should be systematically compiled to determine if MPN_398 meets the criteria for classification as a virulence factor, similar to the analysis performed for IbpM which demonstrated roles in cytotoxicity .

How should I design experiments to understand MPN_398's role in the context of antigenic variation?

M. pneumoniae uses antigenic variation as a key immune evasion strategy, with approximately 8% of its genome consisting of repetitive elements that facilitate this variation . To investigate MPN_398's potential role:

  • Sequence variation analysis:

    • Compare MPN_398 sequences across multiple clinical isolates

    • Identify variable and conserved regions

    • Examine proximity to known repetitive elements in the genome

  • Recombination assessment:

    • Search for recombination hotspots near the MPN_398 locus

    • Test for evidence of recombination events using appropriate algorithms

  • Immunological characterization:

    • Express different variants of MPN_398 if identified

    • Compare antibody recognition patterns from patients with recurrent infections

    • Assess if antibodies against one variant cross-react with others

  • Long-term evolution studies:

    • Serial passage experiments under immune selection pressure

    • Track sequence changes in MPN_398 over time

    • Correlate changes with immune evasion capabilities

These experiments should be designed using the DoE approach to efficiently examine multiple factors and their interactions .

What advanced structural biology techniques would be most informative for studying MPN_398?

For comprehensive structural characterization:

  • X-ray crystallography optimization:

    • Apply sparse matrix screening for initial crystallization conditions

    • Optimize promising conditions using DoE approach

    • Variables to optimize: protein concentration, precipitant concentration, pH, additives

    • Response parameters: crystal size, diffraction quality, resolution

  • Cryo-electron microscopy:

    • Particularly valuable if MPN_398 forms large complexes with other proteins

    • Sample preparation optimization: grid type, buffer conditions, concentration

    • Combinatorial screening of freezing conditions

  • NMR spectroscopy for dynamics:

    • Isotopic labeling optimization for recombinant protein

    • Study protein flexibility and conformational changes

    • Identify regions involved in protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Map solvent-accessible regions and binding interfaces

    • Compare different conditions to detect conformational changes

    • Integrate with computational modeling

Data from multiple structural techniques should be integrated to build a comprehensive understanding of structure-function relationships.

How can systems biology approaches enhance our understanding of MPN_398 function?

Systems-level analysis provides context for MPN_398 function:

  • Multi-omics integration:

    • Correlate MPN_398 expression (transcriptomics) with protein abundance (proteomics)

    • Map metabolic changes (metabolomics) associated with MPN_398 expression

    • Construct regulatory networks including MPN_398

  • Network analysis:

    • String database integration to identify high-confidence interaction partners

    • Pathway enrichment analysis of connected proteins

    • Network perturbation studies following MPN_398 manipulation

  • Host-pathogen interaction mapping:

    • Dual RNA-seq of infected host cells with wild-type vs. MPN_398 mutants

    • Phosphoproteomics to detect signaling changes in host cells

    • Systematic screening of host factors required for MPN_398 function

  • Mathematical modeling:

    • Develop predictive models of MPN_398's impact on cellular processes

    • Simulate effects of targeting MPN_398 on bacterial fitness

    • Identify potential emergent properties from network interactions

Integration of these approaches can reveal unexpected functions and place MPN_398 in the broader context of M. pneumoniae pathogenesis.

How can I apply Design of Experiments (DoE) to optimize recombinant MPN_398 expression?

DoE methodology offers significant advantages over traditional one-factor-at-a-time optimization:

  • Factorial design setup:

    • Define critical factors: temperature (20-37°C), inducer concentration (0.1-1mM IPTG), induction time (2-24h), media composition

    • Use software packages to design minimal experiments covering factor combinations

    • Include center points to detect non-linear relationships

  • Response variables measurement:

    • Total yield of soluble protein (mg/L culture)

    • Purity after initial purification step (%)

    • Biological activity (if assay available)

  • Statistical analysis of results:

    • Generate response surface models to identify optimal conditions

    • Validate predicted optimal conditions with confirmation experiments

    • Analyze interactions between factors to understand their combined effects

FactorLow LevelCenter PointHigh Level
Temperature (°C)202837
IPTG (mM)0.10.51.0
Induction time (h)41224
MediumLBTBAuto-induction

DoE software can generate contour plots showing how different factor combinations affect yield and solubility, enabling rational selection of optimal conditions with statistical confidence .

What strategies can improve solubility of recombinant MPN_398?

Mycoplasma proteins often present solubility challenges when expressed in heterologous systems:

  • Fusion tag screening:

    • Test multiple solubility-enhancing tags: MBP, SUMO, TrxA, GST

    • Compare solubility enhancement quantitatively

    • Assess tag removal efficiency if tag-free protein is needed

  • Co-expression approaches:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Include potential binding partners identified in interaction studies

    • Test specialized foldases if disulfide bonds are present

  • Expression condition modifications:

    • Lower temperature expression (16-20°C)

    • Osmolyte addition to culture medium (sorbitol, glycerol, betaine)

    • Mild induction using lower IPTG concentrations or auto-induction media

  • Protein engineering:

    • Truncation constructs based on domain predictions

    • Surface entropy reduction to enhance solubility

    • Directed evolution for enhanced solubility if high-throughput screening is available

Systematic combination of these approaches using DoE methodology will efficiently identify optimal solubilization strategies .

How might characterization of MPN_398 contribute to understanding M. pneumoniae pathogenesis?

Uncharacterized proteins often reveal novel aspects of pathogenesis:

  • Potential virulence mechanisms:

    • If MPN_398 shows similarity to immune evasion factors like IbpM (immunoglobulin-binding protein)

    • Possible roles in NET degradation (similar to mpn491 nuclease)

    • Potential antioxidant functions protecting against host ROS (like mpn668)

  • Host-pathogen interaction insights:

    • Novel adhesion mechanisms beyond known adhesins

    • Intracellular survival strategies facilitating persistent infection

    • Modulation of host immune responses

  • Evolutionary considerations:

    • Conservation across Mycoplasma species indicating essential functions

    • Acquisition through horizontal gene transfer suggesting adaptive advantages

    • Involvement in the minimal gene set required for cellular life

Characterization could reveal unexpected pathogenesis mechanisms, particularly given M. pneumoniae's reduced genome and unique adaptations as an obligate human pathogen.

How can bioinformatic findings about MPN_398 be validated in the context of M. pneumoniae's minimal genome?

Mycoplasma's minimal genome presents unique validation challenges:

  • Essential gene determination:

    • Transposon mutagenesis to determine if MPN_398 is essential

    • CRISPRi for controlled knockdown if essential

    • Growth curve analysis under various stress conditions

  • Complementary approaches integration:

    • Validate function predictions from multiple bioinformatic tools (minimum 2-3 confirmations)

    • Combine homology predictions with structural modeling

    • Correlate predictions with expression patterns during infection

  • Cross-species functional conservation:

    • Test functional complementation in related Mycoplasma species

    • Compare with homologs in other minimal genome organisms

    • Assess conservation of protein-protein interaction networks

  • Targeted mutagenesis:

    • Site-directed mutagenesis of predicted functional residues

    • Domain swapping with characterized homologs

    • Truncation analysis to identify minimal functional units

These approaches collectively provide robust validation while accounting for the constraints of working with minimal genome organisms.

What quality control measures are essential when working with recombinant MPN_398?

Rigorous quality control ensures reliable research outcomes:

  • Protein identity verification:

    • Mass spectrometry confirmation of intact mass

    • Peptide mapping with >80% sequence coverage

    • Western blot with tag-specific and protein-specific antibodies

  • Purity assessment:

    • SDS-PAGE with densitometry (>95% purity standard)

    • Size exclusion chromatography to detect aggregates

    • Dynamic light scattering for homogeneity analysis

  • Functional integrity verification:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to assess stability

    • Activity assays based on predicted function

  • Endotoxin and contaminant testing:

    • Limulus Amebocyte Lysate (LAL) assay for endotoxin

    • Host cell protein ELISA for expression system contaminants

    • Nucleic acid quantification (A260/A280 ratio)

These measures should be systematically documented before proceeding to functional studies to ensure reproducibility and reliability of subsequent experiments.

How should contradictory functional predictions for MPN_398 be resolved?

Resolving conflicting predictions requires a systematic approach:

  • Prediction reliability assessment:

    • Compare confidence scores across prediction methods

    • Prioritize predictions from tools specializing in bacterial proteins

    • Weight predictions based on evolutionary conservation

  • Multi-faceted experimental validation:

    • Design experiments that can distinguish between competing hypotheses

    • Test multiple predicted functions in parallel

    • Use negative controls to rule out nonspecific activities

  • Reconciliation strategies:

    • Consider multifunctionality (protein may perform multiple roles)

    • Investigate context-dependent functions (different activities under different conditions)

    • Examine domain-specific functions if multiple domains are present

  • Iterative refinement process:

    • Update predictions based on experimental results

    • Re-analyze using newer databases and algorithms

    • Incorporate structural data as it becomes available

This integrated approach acknowledges the complexity of protein function and the limitations of individual prediction methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.