Recombinant Mycoplasma pneumoniae Uncharacterized protein MG286 homolog (MPN_405)
Shipped with Ice Packs 
In Stock 
Description
Production and Applications
MPN_405 is produced as a recombinant protein for research purposes. Key production and application details are summarized below:
Applications
-
Antigenic Studies: Potential utility in serodiagnostic assays, though untested .
-
Protein Interaction Studies: Hypothetical use in exploring pathogenic mechanisms (no published data).
Pathway and Interaction Data
Comparative Analysis
While M. pneumoniae proteins like P1, P30, and MPN456 are well-studied for adhesion, cytadherence, and immune evasion , MPN_405 has not been implicated in these processes. Recombinant antigens (e.g., P1, P30) have demonstrated diagnostic utility in serodiagnosis , but MPN_405’s role remains undefined.
Challenges and Future Directions
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MPN_405; F11_orf197; MP433; Uncharacterized protein MG286 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_405
Target Protein Sequence
MIFSISKRKLICGFSLVALTIAGIVGGVYLVTKNNQQTTPQTNHFNVADPVNKVPNWRKL
GPETQRELRDLLYPLDDTGYFIYKYGAISRYLQSQKELDELVDYRTVLPSTQKHFKYDSF
NQSVLESKLRKWLMKAIKQHPYFQHFEFDPVLKAQYNINIPAQKITVNAVWFYKKDNDLT
TGKPIRYWDQFEIKLKQ
Uniprot No.
Target Background
Database Links
KEGG: mpn:MPN405
Subcellular Location
Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
