Recombinant Mycoplasma pneumoniae Uncharacterized protein MG302 homolog (MPN_431)

Shipped with Ice Packs
In Stock

Description

Definition and Background

MPN_431 is a 317-amino-acid protein encoded by the MPN_431 gene in Mycoplasma pneumoniae. It is classified as an uncharacterized protein homolog of MG302, with potential roles in bacterial survival or pathogenesis. The recombinant version is produced in Escherichia coli with an N-terminal His-tag for purification and detection purposes .

Key Features:

  • UniProt ID: P75357

  • Synonyms: A05_orf317, MP410

  • Gene Name: MPN_431

Genomic Context and Homology

The MPN_431 gene is part of M. pneumoniae’s highly reduced genome (~800 kb). While its exact function remains uncharacterized, genomic studies highlight the following:

  • Repetitive Elements: M. pneumoniae’s genome contains RepMP sequences that drive antigenic variation in surface adhesins (e.g., P1, P40/P90) . Although MPN_431 is not directly linked to these elements, its homology to MG302 suggests potential involvement in similar recombination-driven immune evasion mechanisms .

  • Genetic Stability: Unlike hypervariable adhesins, MPN_431 exhibits low sequence variability across strains, indicating a conserved but unresolved role .

Research Applications

MPN_431 is primarily utilized in:

  • Antigenic Studies: As a recombinant protein, it serves as a tool for antibody production and epitope mapping .

  • Pathogenesis Research: Investigations into M. pneumoniae’s immune evasion strategies often include uncharacterized proteins like MPN_431 .

  • Diagnostic Development: Potential use in ELISA or immunoblot assays for detecting M. pneumoniae infections .

Current Research and Knowledge Gaps

Despite its availability as a recombinant product, MPN_431’s biological role remains elusive:

  • Functional Studies: No direct evidence links MPN_431 to virulence or metabolic pathways. Its homology to MG302, a protein of unknown function in other mycoplasmas, suggests conserved but cryptic roles .

  • Antigenic Variation: While RepMP-driven recombination is well-documented for adhesins like P1 , MPN_431 lacks RepMP sequences, implying distinct evolutionary constraints .

Future Directions

Further research is needed to:

  • Elucidate MPN_431’s interaction with host immune components.

  • Explore its potential as a vaccine candidate or diagnostic marker.

  • Investigate post-translational modifications that may influence function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MPN_431; A05_orf317; MP410; Uncharacterized protein MG302 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_431
Target Protein Sequence
MTSKNFLSQLPPVLKLWWWIISLVVAFLPLGLHGLIIINAIFFALVIVVERKLKTFAIIF GWLLFFFWFNIVVNGFIFLPNSSALASQNENFLGHFIYSGGEQFGGVSWWSVNTRSLLRS LVIALRISMLFATSFLLTASTSIYELAFGVERLCTPLRYLKIKTQPLSILFALVFKLLPI VKGELKRIKQAQAIRGFKYGKLAFLNPVKLKTLFIPVLLSTVKKTEAVAFALQAKGYQLD NPNKTHYLQKYNLWGGIVFLGLFVLLSCLLMVNNWHLVYWTNPHYSFTFTHQNFCFFKQI SSPQLLAFWQLELLAIG
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN431

Protein Families
CbiQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_431 and what is its genomic context in Mycoplasma pneumoniae?

MPN_431 is an uncharacterized protein encoded in the Mycoplasma pneumoniae genome, identified as a homolog of MG302. The full-length protein consists of 317 amino acids . The protein is part of the limited protein complement of M. pneumoniae, which has a reduced genome characteristic of the Mycoplasma genus. Based on comparative genomics, MPN_431 (also annotated as MP410 or A05_orf317) is conserved across different M. pneumoniae strains, suggesting potential functional importance despite its uncharacterized status .

Methodologically, researchers investigating this protein should conduct comparative genomic analyses across multiple Mycoplasma species to identify conserved domains and potential functional relationships. Genomic context analysis examining neighboring genes may provide insights into potential operons or functional units.

How is recombinant MPN_431 typically expressed and purified?

The recombinant MPN_431 protein is commonly expressed as a His-tagged fusion protein in E. coli expression systems . The typical workflow includes:

  • Cloning: The full-length gene (encoding amino acids 1-317) is cloned into an expression vector with an N-terminal His-tag.

  • Expression: Transformation into an E. coli strain optimized for recombinant protein expression.

  • Induction: IPTG-induction of protein expression under optimized conditions.

  • Lysis: Cell disruption using sonication or mechanical methods in appropriate buffer systems.

  • Purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins.

  • Storage: The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

For optimal results, researchers should:

  • Monitor protein expression levels using SDS-PAGE

  • Confirm purity (>90% is standard)

  • Validate protein identity via Western blotting or mass spectrometry

  • Perform stability testing under various storage conditions

What approaches can be used to determine the function of MPN_431?

As an uncharacterized protein, determining the function of MPN_431 requires multiple complementary approaches:

ApproachMethodologyExpected Outcomes
Bioinformatic predictionSequence homology, domain analysis, genomic contextPreliminary functional hypotheses
Protein-protein interactionCo-immunoprecipitation, Yeast two-hybrid, Proximity labelingIdentification of interaction partners
Subcellular localizationImmunofluorescence microscopy, Fractionation studiesCellular compartment information
Gene knockout/knockdownCRISPR-Cas9 or antisense RNA in modified MycoplasmaPhenotypic effects of protein absence
Heterologous expressionExpression in model organismsEffects on host systems
Structural studiesX-ray crystallography, NMR, Cryo-EMStructure-function relationships

Researchers should initially focus on determining whether MPN_431 participates in known Mycoplasma pneumoniae virulence mechanisms. Given that M. pneumoniae has a limited set of virulence factors, including adhesins and the CARDS toxin, investigating potential interactions with these pathways would be valuable . The importance of membrane proteins in M. pneumoniae pathogenesis suggests that MPN_431, with its predicted membrane association, could play a role in host-pathogen interactions.

How might MPN_431 contribute to Mycoplasma pneumoniae pathogenesis?

While direct evidence for MPN_431's role in pathogenesis is not established in the provided search results, potential contributions can be hypothesized based on what is known about M. pneumoniae virulence mechanisms.

M. pneumoniae pathogenesis involves:

  • Adherence to respiratory epithelium: Mediated by adhesin proteins, primarily P1 (the main adhesin)

  • Cytotoxicity: Via CARDS toxin and other virulence factors

  • Immune modulation: Through interactions with host immune components

Research approaches to investigate MPN_431's potential role in pathogenesis should include:

  • Testing for interactions with known adhesins or adhesion-related proteins

  • Assessing effects on epithelial cell cultures when exposed to recombinant MPN_431

  • Comparing virulence between wild-type and MPN_431 knockout strains

  • Investigating potential immunomodulatory properties by exposing immune cells to purified protein

  • Analyzing whether antibodies against MPN_431 provide protection in infection models

What experimental systems are available for studying MPN_431 function in vitro?

Several experimental systems can be employed to study MPN_431:

  • Recombinant protein interaction studies:

    • Surface plasmon resonance (SPR) to measure binding to potential partners

    • ELISA-based interaction assays with host proteins

    • Pull-down assays using His-tagged MPN_431 to identify binding partners

  • Cell culture models:

    • Human respiratory epithelial cell lines (A549, BEAS-2B)

    • Co-culture systems with epithelial and immune cells

    • Measurement of cellular responses upon exposure to MPN_431

  • Membrane model systems:

    • Liposome incorporation assays to study membrane interactions

    • Planar lipid bilayers to study potential channel/transport functions

    • Giant unilamellar vesicles (GUVs) to visualize membrane interactions

  • Structural biology approaches:

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry for conformational studies

    • Thermal shift assays to identify stabilizing conditions or binding partners

Each system provides different insights, and researchers should select methods that align with their specific hypotheses about MPN_431 function.

What are the optimal conditions for maintaining MPN_431 stability during experiments?

Based on the product information, MPN_431 requires specific handling to maintain stability:

  • Storage conditions:

    • Long-term: Store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

    • Working stocks: Can be stored at 4°C for up to one week

  • Buffer composition:

    • Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended

    • For long-term storage, addition of glycerol to a final concentration of 30-50% is advised

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (final concentration 5-50%) for long-term storage

  • Experimental considerations:

    • Monitor protein stability using analytical techniques like size-exclusion chromatography

    • Confirm activity/folding periodically if functional assays are available

    • Consider adding protease inhibitors if working with cellular extracts

How can protein-protein interactions of MPN_431 be studied effectively?

Given the limited knowledge about MPN_431 function, identifying its interaction partners is crucial. The following approaches are recommended:

  • Unbiased screening approaches:

    • Yeast two-hybrid screening against M. pneumoniae or human lung epithelial cDNA libraries

    • Proximity labeling (BioID or APEX) in Mycoplasma or heterologous systems

    • Co-immunoprecipitation followed by mass spectrometry

  • Targeted interaction studies:

    • Direct ELISA using recombinant MPN_431 and candidate partners

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for quantitative interaction analysis

  • Validation approaches:

    • Co-localization studies using fluorescently tagged proteins

    • FRET/BRET analysis for proximity verification

    • Mutual co-immunoprecipitation

  • Functional validation:

    • Competition assays to disrupt identified interactions

    • Domain mapping to identify interaction interfaces

    • Mutagenesis of key residues to disrupt specific interactions

When designing these experiments, researchers should consider:

  • Whether to use full-length protein or specific domains

  • The potential impact of tags on protein interactions

  • The need for membrane mimetics when studying a putative membrane protein

  • Controls for non-specific binding

What considerations are important for developing antibodies against MPN_431?

Developing specific antibodies against MPN_431 is important for localization, interaction, and functional studies. Key considerations include:

  • Antigen design strategies:

    • Full-length recombinant protein (suitable for polyclonal antibodies)

    • Synthetic peptides from predicted extracellular/exposed regions

    • Fragments excluding transmembrane domains

  • Antibody production approaches:

    • Polyclonal antibodies: Faster production but potential cross-reactivity

    • Monoclonal antibodies: Higher specificity but more resource-intensive

    • Recombinant antibodies: Allows for engineering specific properties

  • Validation requirements:

    • Western blot against recombinant protein and Mycoplasma lysates

    • Immunoprecipitation efficiency testing

    • Pre-adsorption controls to confirm specificity

    • Testing against MPN_431 knockout strains (negative control)

  • Application-specific considerations:

    • For microscopy: Test fixation compatibility and background levels

    • For flow cytometry: Validate surface accessibility of epitopes

    • For ELISA: Determine optimal coating and detection conditions

How can bioinformatic approaches help predict MPN_431 function?

Given the uncharacterized nature of MPN_431, bioinformatic analyses are crucial starting points:

  • Sequence-based predictions:

    • Multiple sequence alignment across Mycoplasma species to identify conserved residues

    • Hidden Markov Model searches to detect distant homologs

    • Motif scanning for known functional motifs

  • Structure-based predictions:

    • Ab initio structure prediction using AlphaFold or RoseTTAFold

    • Structural homology modeling based on related proteins

    • Binding site prediction to identify potential interaction surfaces

  • Genomic context analysis:

    • Examination of neighboring genes for functional relationships

    • Operon prediction across Mycoplasma species

    • Phylogenetic profiling to identify co-evolving genes

  • Expression pattern analysis:

    • Mining transcriptomic data for co-expression patterns

    • Identifying conditions where MPN_431 is differentially expressed

    • Correlation with other virulence-associated genes

The most robust approach combines multiple prediction methods and integrates results to generate testable hypotheses about protein function.

How should researchers interpret contradictory results in MPN_431 functional studies?

Contradictory results are common when studying uncharacterized proteins. Researchers should:

  • Examine methodological differences:

    • Expression systems used (E. coli vs. eukaryotic cells)

    • Tags and fusion partners that might affect function

    • Buffer conditions and protein preparation methods

    • Cell lines or experimental systems employed

  • Consider protein state and modifications:

    • Post-translational modifications present or absent

    • Oligomerization state of the protein

    • Native membrane environment vs. soluble preparations

  • Assess biological context:

    • Different M. pneumoniae strains (p1 type 1 vs. type 2)

    • Growth conditions and bacterial life cycle stage

    • Host cell type and activation state

  • Reconciliation strategies:

    • Perform side-by-side comparisons under identical conditions

    • Use multiple complementary techniques to address the same question

    • Consider context-dependent functions where both results may be valid

A systematic approach to resolving contradictions often leads to deeper insights into protein function and regulation.

What research gaps exist in understanding MPN_431 and how might they be addressed?

Current knowledge about MPN_431 is limited, with several important gaps:

  • Fundamental characterization gaps:

    • Structure determination (X-ray crystallography or Cryo-EM)

    • Definitive subcellular localization

    • Basic biochemical properties and activities

  • Functional understanding gaps:

    • Role in M. pneumoniae physiology

    • Contribution to pathogenesis

    • Interaction with host components

  • Clinical relevance gaps:

    • Expression during human infection

    • Immunogenicity and antibody responses

    • Potential as diagnostic marker or vaccine target

To address these gaps, a coordinated research approach is needed:

Research GapProposed ApproachesExpected Timeline
Structure determinationX-ray crystallography, Cryo-EM1-2 years
Subcellular localizationImmunogold EM, Fractionation studies6-12 months
Interaction partnersComprehensive interactome studies1-2 years
Function in pathogenesisAnimal infection models, Cell culture systems2-3 years
Immunological relevanceAnalysis of patient sera, Immunization studies1-3 years

What potential does MPN_431 have as a diagnostic marker for M. pneumoniae infections?

The potential of MPN_431 as a diagnostic marker should be evaluated systematically:

  • Expression analysis:

    • Confirm expression during human infection

    • Quantify relative abundance compared to established markers

    • Determine temporal expression pattern during infection cycle

  • Serological assessment:

    • Measure antibody responses to MPN_431 in patient sera

    • Compare sensitivity and specificity to established serological tests

    • Evaluate correlation with disease severity and progression

The immunogenicity of M. pneumoniae proteins is an important factor in their diagnostic utility. While major antigens like the P1 protein are well-documented to induce strong antibody responses , the immunogenicity of MPN_431 needs to be specifically investigated. Researchers should consider examining:

  • MPN_431-specific antibody titers in convalescent sera

  • Kinetics of antibody development during infection

  • Persistence of antibodies after resolution of infection

  • Cross-reactivity with proteins from other pathogens

How can structural studies of MPN_431 contribute to understanding M. pneumoniae biology?

Structural characterization of MPN_431 would provide valuable insights:

  • Functional insights from structure:

    • Identification of potential active sites

    • Recognition of structural motifs shared with proteins of known function

    • Prediction of interaction interfaces

  • Evolutionary perspectives:

    • Structural conservation across Mycoplasma species

    • Identification of structural adaptations specific to M. pneumoniae

    • Insights into protein evolution within genome-reduced organisms

  • Membrane integration analysis:

    • Positioning within the membrane

    • Potential channels or pores

    • Structural basis for membrane association

  • Applications of structural knowledge:

    • Structure-based design of inhibitors if functionally relevant

    • Engineering modified versions for research tools

    • Rational design of stable fragments for antibody production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.