Recombinant Mycoplasma pneumoniae Uncharacterized protein MG320 homolog (MPN_455)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized using codon-optimized sequences cloned into E. coli vectors, followed by affinity chromatography (heparin Sepharose) and dialysis . Quality control metrics include:

  • Purity: ≥85% verified by SDS-PAGE

  • Host Systems: Compatible with yeast, baculovirus, and mammalian cell systems

Functional Insights

While MPN_455 remains uncharacterized, emerging evidence suggests roles in:

  • Host-Pathogen Interactions: DUF16 family proteins (including MPN_455) activate the NOD2/RIP2/NF-κB pathway in macrophages, inducing pro-inflammatory cytokines like TNF-α .

  • Structural Motifs: A conserved region (amino acids 13–90) is critical for immune activation .

Interaction Network

MPN_455 homologs participate in protein-DNA interactions linked to antigenic variation mechanisms in M. pneumoniae:

Interacting PartnerFunctionMethod of Detection
NOD2Intracellular receptor mediating inflammatory responses GST pull-down, Co-IP, LC-MS/MS
RepMP ElementsRepetitive sequences enabling recombination for immune evasion Homology modeling

Immune Evasion and Adaptation

  • MPN_455 is encoded near RepMP elements, which facilitate recombination-driven antigenic variation in adhesion proteins (e.g., P1, P40) .

  • RecA homologs (e.g., MPN490) mediate recombination between RepMP sequences, potentially influencing MPN_455 expression .

Phosphorylation Landscape

  • While not directly observed in phosphoproteome studies, MPN_455’s proximity to kinases (e.g., PrkC) suggests post-translational regulation . PrkC phosphorylates adhesion proteins like HMW3 and P41, critical for cytadherence .

Unresolved Questions and Future Directions

  1. Functional Characterization: The biochemical activity of MPN_455 remains unknown. Proposed studies include enzymatic assays and structural analysis (e.g., X-ray crystallography).

  2. Role in Pathogenesis: Does MPN_455 directly contribute to M. pneumoniae adhesion or toxin production (e.g., CARDS toxin) ?

  3. Therapeutic Potential: Could targeting MPN_435-NOD2 interactions modulate inflammatory damage in chronic infections ?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_455; H08_orf287; MP386; Uncharacterized protein MG320 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_455
Target Protein Sequence
MINQANNQVNFSEQQFVHHKRFSVIRLTFSVAAIGILFIFLIGFGVQQLLTNTTSLGTLA SDIRTLGTIAFVASLVSLILYFVTAFKLRNRNTTLAWFWGLIIADVISYGITLGVLLTLA TTQLRELIDFKFSDIVFAFLGAALVYGTVWGLSALPSQQRRYQQTQTLFRIFIWAFFISI IASLLTFVLNFTVFRGGRTNILDLLFPGLSLIVGGIFSLLSVYFVCLQIRNEQDLVKLYE SQDPALAKAQMWRSALFFGAWLVSSFMNLVYFILRIILLTRNLSRAF
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN455

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How was MPN_455 identified in the Mycoplasma pneumoniae genome?

The methodical approach to genome re-annotation involved identifying intergenic regions that could potentially encode proteins, verifying transcription through mRNA expression data, and comparing predicted proteins with sequences from other organisms to determine potential functions and homologies .

What is currently known about the potential function of MPN_455?

Despite being classified as an "uncharacterized protein," several features suggest possible functions for MPN_455. Sequence analysis indicates it is a membrane protein with multiple transmembrane domains, suggesting potential roles in membrane transport or signaling. The protein shares homology with MG320 from Mycoplasma genitalium, which provides clues to its evolutionary conservation and potential functional importance .

What are the optimal storage conditions for recombinant MPN_455?

For optimal stability and activity retention of recombinant MPN_455, the protein should be stored in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein. The recommended storage temperature is -20°C for regular use. For extended storage periods, maintaining the protein at either -20°C or -80°C is advised to minimize degradation .

It's crucial to avoid repeated freezing and thawing cycles as these can significantly degrade protein quality and activity. For ongoing experiments, working aliquots can be prepared and stored at 4°C for up to one week without significant loss of activity. When planning experiments, researchers should consider creating multiple small-volume aliquots during initial thawing to minimize the need for repeated freeze-thaw cycles .

What expression systems are most effective for producing recombinant MPN_455?

Based on available data, E. coli expression systems have been successfully employed for the recombinant production of MPN_455. The protein has been produced with various tags, with His-tagged versions being commercially available. When designing an expression strategy, researchers should consider that the optimal tag type may vary depending on the specific experimental requirements and downstream applications .

For effective expression in E. coli, codon optimization might be necessary due to the significant differences in codon usage between Mycoplasma pneumoniae and E. coli. Additionally, careful consideration of induction conditions, including temperature, inducer concentration, and duration, is essential to maximize yield while maintaining proper protein folding. Since MPN_455 contains predicted transmembrane domains, expression strategies that account for the challenges associated with membrane protein production may yield better results .

What analytical methods are recommended for verifying the purity and identity of recombinant MPN_455?

A multi-faceted approach is recommended for comprehensive verification of recombinant MPN_455:

  • SDS-PAGE analysis should be performed to assess purity and approximate molecular weight

  • Western blotting using antibodies against the protein or its tag for identity confirmation

  • Mass spectrometry for precise molecular weight determination and sequence verification

  • Circular dichroism spectroscopy to evaluate secondary structure integrity

For applications requiring high confidence in protein identity, peptide mass fingerprinting following tryptic digestion can provide detailed sequence confirmation. Additionally, N-terminal sequencing can verify the correct translation start site, which is particularly relevant given the documented cases of N-terminal extensions in other Mycoplasma pneumoniae proteins during genome re-annotation efforts .

How can I determine the membrane topology of MPN_455?

Determining the membrane topology of MPN_455 requires a combination of computational prediction and experimental validation approaches:

  • Begin with computational prediction tools that analyze the amino acid sequence for hydrophobic regions and potential transmembrane domains, such as TMHMM, Phobius, or TOPCONS.

  • Follow with experimental verification using techniques such as:

    • Protease protection assays to identify which regions are exposed or protected

    • Site-directed fluorescence labeling at predicted loop regions

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • Epitope insertion followed by antibody accessibility testing in intact versus permeabilized cells

  • For higher resolution analysis, more advanced techniques can be employed:

    • Cryo-electron microscopy for structural determination

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

    • Fluorescence resonance energy transfer (FRET) to measure distances between domains

The sequence of MPN_455 suggests multiple transmembrane domains, with hydrophobic regions that likely span the membrane multiple times. A methodical approach combining these techniques will provide complementary data to establish a confident topology model .

What approaches can be used to identify potential interaction partners of MPN_455?

To identify potential interaction partners of MPN_455, researchers can employ several complementary approaches:

  • Affinity Purification coupled with Mass Spectrometry (AP-MS): Using tagged versions of MPN_455 (such as His-tagged recombinant protein) to pull down interacting proteins, followed by MS identification. This approach should include proper controls to distinguish genuine interactions from non-specific binding .

  • Bacterial Two-Hybrid Systems: Adapted for mycoplasma proteins, these systems can detect protein-protein interactions in vivo. The choice of system should consider the membrane localization of MPN_455.

  • Crosslinking Mass Spectrometry: Using chemical crosslinkers to stabilize transient interactions before purification and MS analysis, providing insights into both stable and transient interactions.

  • Co-immunoprecipitation: Using antibodies against MPN_455 to precipitate the protein along with its interaction partners from Mycoplasma pneumoniae lysates.

  • Proximity-Based Labeling: Techniques such as BioID or APEX2, where MPN_455 is fused to an enzyme that labels proximal proteins, allowing identification of the neighborhood interactome.

For data analysis, comparison with interaction databases and ortholog information from related species can help validate findings and place them in biological context .

How can I investigate the potential role of MPN_455 in Mycoplasma pneumoniae pathogenesis?

Investigating the potential role of MPN_455 in Mycoplasma pneumoniae pathogenesis requires a multi-faceted approach:

  • Gene Knockout or Knockdown Studies: Generate MPN_455 deletion mutants or use RNA interference approaches to reduce expression, then assess changes in bacterial fitness, growth, and virulence in appropriate models. Given the minimal genome of M. pneumoniae, careful verification is needed to ensure the gene is not essential for basic survival.

  • Transcriptional Analysis: Examine expression patterns of MPN_455 under different conditions (e.g., during infection, stress responses, or environmental changes) using RT-qPCR or RNA-seq to identify conditions that regulate its expression.

  • Host-Pathogen Interaction Studies: Use cell culture infection models to compare wild-type and MPN_455-deficient strains for differences in:

    • Adhesion to host cells

    • Invasion efficiency

    • Intracellular survival

    • Host immune response activation

    • Cytopathic effects

  • Protein Localization: Determine if MPN_455 is exposed on the bacterial surface or secreted using immunofluorescence microscopy and subcellular fractionation, which would suggest direct interaction with host components.

  • Animal Models: Assess the virulence of MPN_455 mutants in appropriate animal models of M. pneumoniae infection, measuring parameters such as bacterial load, inflammatory responses, and disease progression.

The interpretation of results should consider the potential redundancy of virulence factors and compensatory mechanisms that may mask phenotypes in single-gene knockout studies .

How conserved is MPN_455 across different Mycoplasma species and strains?

The conservation of MPN_455 across Mycoplasma species follows a pattern that reflects evolutionary relationships within the genus. Analysis of orthologous sequences reveals:

  • Within M. pneumoniae strains: The protein is highly conserved (>95% sequence identity) across clinical and reference strains of M. pneumoniae, suggesting functional importance.

  • Closest homology: The protein shows significant homology to MG320 in Mycoplasma genitalium, as reflected in its name "MG320 homolog." This cross-species conservation between two human pathogens suggests potential importance in host-pathogen interactions or essential cellular functions .

  • Broader Mycoplasma genus: Moderate sequence conservation (40-60% identity) is observed with corresponding proteins in related species like M. genitalium and some other human and animal Mycoplasma pathogens.

  • Conservation pattern: The transmembrane domains show higher conservation than loop regions, suggesting structural constraints on membrane-spanning segments while allowing more variation in exposed regions, possibly reflecting adaptation to different host environments.

The ortholog data indicates that while MPN_455 has recognizable homologs in closely related Mycoplasma species, the conservation becomes less pronounced in more distant species, suggesting possible species-specific adaptations while maintaining core structural features .

What does comparative genomics reveal about the evolutionary history of MPN_455?

Comparative genomic analysis of MPN_455 provides several insights into its evolutionary history:

How can ortholog information be used to predict functional aspects of MPN_455?

Ortholog information provides valuable insights for predicting functional aspects of MPN_455 through several analytical approaches:

  • Functional Transfer: Functions experimentally determined for orthologs in better-characterized species can be cautiously transferred to MPN_455. The identified ortholog relationships should be analyzed for sequence similarity percentages, domain conservation, and evolutionary distance to assess confidence in functional prediction .

  • Conservation Pattern Analysis: Examining which regions of the protein are most conserved across orthologs can identify functionally important domains:

    • Highly conserved regions likely represent functional domains or critical structural elements

    • Variable regions may indicate species-specific adaptations or less functionally constrained regions

  • Co-evolution Networks: Analyzing genes that co-evolve with MPN_455 across multiple genomes can reveal functional associations and potential pathway involvement. Genes that maintain proximity across genomes often have related functions.

  • Synthetic Approaches: For uncharacterized proteins like MPN_455, combining ortholog analysis with other computational methods strengthens functional prediction:

    • Protein structure prediction

    • Subcellular localization prediction

    • Transmembrane topology modeling

    • Motif identification

  • Experimental Validation Strategy: Ortholog information can guide the design of targeted experiments:

    • Prioritizing conserved amino acids for site-directed mutagenesis

    • Identifying potential interaction partners based on known interactions of orthologs

    • Designing chimeric proteins that swap domains with characterized orthologs to test functional hypotheses

When applying this approach to MPN_455, researchers should be mindful that while it shows homology to MG320 from M. genitalium, both proteins remain functionally uncharacterized, limiting direct functional transfer but offering opportunities for comparative experimental approaches .

What are the best approaches for generating antibodies against MPN_455 for research applications?

Generating effective antibodies against MPN_455 presents unique challenges due to its multiple transmembrane domains. A systematic approach includes:

  • Epitope Selection Strategy:

    • Computational prediction of antigenic regions using algorithms that analyze hydrophilicity, surface probability, and antigenicity

    • Prioritization of hydrophilic loops predicted to be exposed based on topology models

    • Selection of multiple epitopes from different regions of the protein to increase success probability

  • Antigen Preparation Options:

    • Synthetic peptides corresponding to predicted antigenic regions (15-25 amino acids)

    • Recombinant protein fragments expressing hydrophilic regions

    • Full-length protein in suitable detergent micelles to maintain native conformation

  • Immunization Protocols:

    • Multiple animal hosts (rabbits, mice, guinea pigs) to maximize epitope recognition diversity

    • Prime-boost strategies with different adjuvants to enhance immune response

    • Monitoring of antibody titers throughout immunization to optimize timing of booster injections

  • Antibody Purification and Validation:

    • Affinity purification against the immunizing antigen

    • Comprehensive validation including:

      • Western blotting against recombinant protein

      • Immunofluorescence in M. pneumoniae

      • Immunoprecipitation efficiency testing

      • Cross-reactivity testing against related proteins

For applications requiring monoclonal antibodies, hybridoma screening should include functional assays to identify antibodies that not only bind the protein but potentially modulate its function, providing tools for functional studies .

How can structural biology approaches be applied to study MPN_455?

Structural biology approaches for studying MPN_455 require specialized techniques due to its nature as a membrane protein:

When planning these approaches, researchers should consider generating constructs with thermostabilizing mutations or fusion proteins that have proven successful for other membrane proteins to increase the likelihood of structural determination .

What strategies can be employed to study post-translational modifications of MPN_455?

Investigating post-translational modifications (PTMs) of MPN_455 requires a targeted analytical approach:

  • Comprehensive PTM Profiling:

    • High-resolution mass spectrometry analysis of purified native protein from M. pneumoniae

    • Enrichment strategies for specific PTM types (phosphopeptides, glycopeptides)

    • Comparison of PTM profiles under different growth conditions to identify regulated modifications

  • Site-Specific Modification Analysis:

    • Generation of site-directed mutants at predicted modification sites

    • Assessment of functional consequences using activity assays or localization studies

    • In vitro modification assays to confirm enzymatic modification

  • PTM Enzyme Identification:

    • Co-immunoprecipitation coupled with enzymatic activity assays to identify modifying enzymes

    • Proximity labeling approaches to identify proteins in the vicinity of MPN_455

    • Comparative analysis of PTM patterns in knockout strains lacking specific modifying enzymes

  • Temporal Dynamics of Modifications:

    • Pulse-chase experiments combined with immunoprecipitation and MS analysis

    • Quantitative proteomics with stable isotope labeling to track modification changes over time

    • Development of modification-specific antibodies for tracking specific PTMs

  • Functional Significance Assessment:

    • Creation of modification-mimicking mutants (e.g., phosphomimetic mutations)

    • Protein interaction studies comparing modified and unmodified forms

    • Localization studies to determine if modifications affect protein trafficking

The minimal genome of M. pneumoniae suggests potential efficiency in PTM usage, with modifications potentially serving multiple regulatory functions. Researchers should consider that mycoplasmas may utilize unique or atypical modification systems due to their reduced genomes and distinctive evolutionary history .

How can I resolve solubility issues when working with recombinant MPN_455?

Addressing solubility challenges with recombinant MPN_455 requires a systematic approach targeting its membrane protein nature:

  • Expression Optimization:

    • Lower induction temperature (16-20°C) to slow protein production and improve folding

    • Reduced inducer concentration to prevent aggregation from excessive expression

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J) to assist proper folding

    • Use of specialized E. coli strains designed for membrane protein expression

  • Buffer Optimization Matrix:

    Buffer ComponentRange to TestRationale
    Detergent typeDDM, LDAO, FC-12Different micelle sizes accommodate different proteins
    Detergent concentration1-5× CMCBalance between extraction efficiency and protein stability
    Salt concentration150-500 mM NaClShield electrostatic interactions
    pH6.5-8.5Affect protein charge distribution
    Glycerol5-20%Stabilize hydrophobic regions
    Reducing agents1-5 mM DTT/TCEPPrevent disulfide-mediated aggregation
  • Protein Engineering Approaches:

    • Removal of predicted flexible regions that might promote aggregation

    • Addition of solubility-enhancing tags (MBP, SUMO) with appropriate linkers

    • Construct design focusing on stable domains if full-length protein remains insoluble

  • Extraction and Purification Strategy:

    • Gentle cell lysis methods to prevent protein aggregation

    • Inclusion of stabilizing ligands or lipids during purification

    • Gradient purification approach with step-wise reduction in detergent concentration

  • Quality Control Metrics:

    • Dynamic light scattering to assess homogeneity

    • Thermal stability assays to identify stabilizing conditions

    • Size-exclusion chromatography with multi-angle light scattering to confirm monodispersity

When working with challenging membrane proteins like MPN_455, establishing a reliable folding and stability assay early in the optimization process allows for efficient screening of multiple conditions .

What are the most common difficulties in expressing MPN_455 in heterologous systems and how can they be overcome?

Expressing MPN_455 in heterologous systems presents several challenges with specific solutions:

  • Codon Usage Disparities:

    • Challenge: Mycoplasma pneumoniae uses a different codon preference than common expression hosts

    • Solution: Codon optimization of the MPN_455 sequence for the expression host or use of strains with rare tRNA supplementation

  • Toxicity to Expression Host:

    • Challenge: Membrane protein overexpression can disrupt host membrane integrity

    • Solution: Use tightly controlled inducible promoters, lower expression temperatures, and reduced inducer concentrations

  • Proper Membrane Insertion:

    • Challenge: Heterologous hosts may have different membrane insertion machinery

    • Solution: Co-expression of Mycoplasma pneumoniae signal recognition particle components or use of host-optimized signal sequences

  • Protein Misfolding and Aggregation:

    • Challenge: Complex membrane proteins often misfold in heterologous systems

    • Solution: Expression as fusion with folding enhancers (MBP, SUMO), co-expression with chaperones, or inclusion of chemical chaperones in growth media

  • Post-translational Modification Differences:

    • Challenge: Heterologous hosts may lack specific modification enzymes

    • Solution: Co-expression of necessary modification enzymes or use of eukaryotic expression systems for complex modifications

  • Yield Optimization Strategy:

    Expression ParameterOptimization ApproachExpected Impact
    Host strainC41(DE3), C43(DE3), Lemo21Strains adapted for membrane protein expression
    Growth mediaTB, 2YT with supplementsRicher media support membrane formation
    Induction pointMid-log vs. late-logBalance between cell density and expression capacity
    Harvest timing4-18 hours post-inductionOptimize for folding vs. accumulation
    Cell lysis methodGentle enzymatic vs. mechanicalPreserve native structure during extraction

Systematic optimization using design of experiments (DOE) methodology can efficiently identify optimal conditions from these multiple variables .

How can I verify that recombinant MPN_455 maintains its native conformation and function?

Verifying that recombinant MPN_455 maintains its native conformation requires a multi-faceted approach:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Limited proteolysis patterns compared between recombinant and native protein

    • Thermal stability analysis to determine if the protein exhibits cooperative unfolding

    • Intrinsic fluorescence spectroscopy to assess tertiary structure compactness

  • Functional Validation Approaches:

    • Liposome reconstitution to test membrane integration capability

    • Binding assays for identified interaction partners from Mycoplasma pneumoniae

    • Activity assays based on predicted function (if applicable)

    • Complementation studies in MPN_455 knockout strains

  • Conformation-Specific Probes:

    • Development of conformation-sensitive antibodies

    • Fluorescent dye binding to hydrophobic regions as a folding indicator

    • Site-specific labeling to measure distances between domains using FRET

  • Native vs. Recombinant Comparison:

    • Size-exclusion chromatography profiles

    • Surface accessibility mapping using chemical modification

    • Mass spectrometry fingerprinting of proteolytic fragments

    • Cross-reactivity with antibodies raised against native protein

  • Stability Optimization Matrix:

    ParameterTest ConditionsAssessment Method
    pH stabilitypH 6.0-8.5Intrinsic fluorescence
    Thermal stability4-60°CDSF/nanoDSF
    Time-dependent stability0-7 daysActivity retention
    Freeze-thaw stability1-5 cyclesSEC profile
    Detergent exchangeMultiple detergentsAggregation monitoring

For membrane proteins like MPN_455 where direct functional assays may be challenging due to unknown function, structural integrity combined with binding partner validation often serves as the best available proxy for native-like conformation .

What emerging technologies could advance our understanding of MPN_455 function?

Several cutting-edge technologies hold promise for elucidating the function of uncharacterized proteins like MPN_455:

  • Cryo-Electron Tomography:

    • Application: Visualizing MPN_455 in its native membrane environment within intact Mycoplasma pneumoniae cells

    • Advantage: Reveals spatial organization and potential structural complexes without protein extraction

    • Implementation: Correlative approaches combining fluorescent tagging with tomographic reconstruction

  • Proximity-Based Proteomics:

    • Application: BioID, APEX, or TurboID fusions to MPN_455 to identify neighboring proteins in vivo

    • Advantage: Captures transient interactions and spatial organization within the cellular context

    • Implementation: Comparison of proximity profiles under different conditions to identify condition-specific interactions

  • Single-Molecule Tracking:

    • Application: Following the dynamics of individual MPN_455 molecules in live M. pneumoniae cells

    • Advantage: Reveals diffusion patterns, clustering behavior, and potential activation states

    • Implementation: HaloTag or SNAP-tag fusions with super-resolution microscopy

  • AlphaFold2 and Related AI Structure Prediction:

    • Application: Generating high-confidence structural models of MPN_455

    • Advantage: Provides structural hypotheses to guide experimental design even without crystallographic data

    • Implementation: Combined with molecular dynamics simulations to predict dynamic behavior and binding sites

  • Massively Parallel Reporter Assays:

    • Application: Systematic testing of thousands of MPN_455 variants for function

    • Advantage: Comprehensive structure-function mapping without prior functional knowledge

    • Implementation: Deep mutational scanning with selection for proper membrane integration or protein interaction

These technologies, when integrated with traditional approaches, offer a path to comprehensive functional characterization of MPN_455, moving beyond its current "uncharacterized" status to a detailed understanding of its role in M. pneumoniae biology .

How might studying MPN_455 contribute to our understanding of minimal genomes and cellular evolution?

The study of MPN_455 offers unique insights into minimal genome biology and cellular evolution:

  • Core Function Identification in Minimal Genomes:

    • Mycoplasma pneumoniae possesses one of the smallest genomes among free-living organisms, making each retained protein potentially essential

    • The conservation of MPN_455 across mycoplasma species suggests functional importance despite genome reduction

    • Functional characterization may reveal processes that remain essential even in highly reduced genomes

  • Evolutionary Adaptations in Membrane Systems:

    • As a membrane protein in an organism with simplified cellular architecture, MPN_455 may represent specialized adaptations

    • Comparative analysis with homologs in more complex bacteria can highlight essential vs. specialized membrane functions

    • The protein may exemplify how organisms with reduced genomes maintain necessary membrane functions with fewer components

  • Host-Pathogen Co-evolution Insights:

    • M. pneumoniae is an obligate human pathogen, suggesting MPN_455 may be optimized for function in the human host environment

    • Analysis of selective pressure signatures in the gene sequence across strains may reveal host-adaptation mechanisms

    • Understanding whether the protein interacts with host factors could illuminate co-evolutionary dynamics

  • Minimal Protein Functional Networks:

    • Mapping the interaction network of MPN_455 can reveal how minimal genomes maintain functional modules with fewer components

    • Comparison with homologous networks in more complex bacteria might show network simplification patterns

    • Such analysis contributes to understanding the minimal protein sets required for specific cellular functions

  • Synthetic Biology Applications:

    • Characterization of MPN_455 contributes to the knowledge base for minimal genome design

    • Understanding membrane protein function in minimal genomes informs the design of simplified cellular systems

    • Functional modules involving MPN_455 might be transferable to synthetic minimal cells

The study of this protein represents a window into the evolution of cellular systems under extreme genome reduction pressure, potentially revealing fundamental principles of cellular organization and adaptation .

What computational approaches can predict functional sites or domains in MPN_455?

Advanced computational approaches can reveal functional features in uncharacterized proteins like MPN_455:

  • Integrative Sequence Analysis:

    • Position-specific conservation mapping across orthologs to identify functionally constrained regions

    • Coevolution analysis to detect co-varying residues that might form functional units

    • Detection of short linear motifs that might mediate protein-protein interactions

  • Structural Bioinformatics:

    • Pocket detection algorithms to identify potential binding sites on predicted structures

    • Electrostatic surface mapping to locate regions suitable for specific molecular interactions

    • Molecular dynamics simulations to identify stable conformations and flexible regions

  • Machine Learning Approaches:

    • Feature-based function prediction using trained classifiers

    • Deep learning models integrating sequence, structure, and evolutionary information

    • Network-based function prediction using guilt-by-association principles in protein interaction networks

  • Comparative Genomics Integration:

    • Phylogenetic profiling to correlate presence/absence patterns with other genes

    • Genomic neighborhood analysis to identify functionally related genes

    • Identification of horizontal gene transfer events that might indicate specialized functions

  • Predictive Feature Integration Table:

    Computational ApproachPredicted FeaturesConfidence Metrics
    Transmembrane predictionMembrane topology modelConsensus across multiple algorithms
    Conserved domain searchPotential functional domainsE-value, coverage percentage
    3D structure predictionStructural motifs, binding pocketsAlphaFold confidence score
    Disorder predictionFlexible regions, binding motifsDisorder probability score
    Post-translational modification sitesPotential regulatory pointsAlgorithm-specific scores

By integrating these diverse computational approaches, researchers can generate testable hypotheses about MPN_455 function, prioritizing specific regions and residues for experimental characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.