Recombinant Mycoplasma pneumoniae Uncharacterized protein MG331 homolog (MPN_477)

Shipped with Ice Packs
In Stock

Description

Introduction to Mycoplasma pneumoniae and MPN_477

Mycoplasma pneumoniae is a bacterium known to cause respiratory infections in humans, ranging from mild upper respiratory issues to pneumonia . Lacking a cell wall, this microorganism can evade typical immune responses, leading to chronic infections . MPN_477, also known as uncharacterized protein MG331 homolog, is a protein found in Mycoplasma pneumoniae (strain ATCC 29342 / M129) .

Characteristics of MPN_477

MPN_477 is a protein of 209 amino acids . It shares homology with uncharacterized protein MG331 . The precise function of MPN_477 is currently unknown, which is why it is referred to as an "uncharacterized protein" .

Recombinant Production of MPN_477

Recombinant MPN_477 is produced by inserting the gene encoding the protein into E. coli cells using a DNA expression vector . These cells are then cultured to express the protein, which is subsequently purified from the cell lysate using affinity purification . The recombinant protein often includes tags such as N-terminal 10xHis tag and C-terminal Myc tag fusions to aid in purification and detection . The purity of the recombinant MPN_477 protein is typically greater than 85%, as determined by SDS-PAGE .

Experimental Uses

Recombinant MPN_477 is available for purchase for use in research, including ELISA assays .

RecA Homologs in Mycoplasma pneumoniae

The MPN490 ORF of M. pneumoniae encodes a RecA homolog, a protein involved in DNA recombination and repair . These RecA homologs, including MPN490, play a role in homologous DNA recombination and may be central to recombination between repetitive elements within the M. pneumoniae genome .

Inflammatory Response and M. pneumoniae Proteins

M. pneumoniae can trigger a robust inflammatory reaction by activating Toll-like receptors (TLR2, TLR4) . Lipoproteins in M. pneumoniae have been identified as agents responsible for instigating inflammation through TLR2 and TLR4, although the precise mechanisms remain incompletely understood . One M. pneumoniae protein, DUF16, can enter macrophages and induce an inflammatory response through the NOD2/RIP2/NF-κB pathway .

Relevant Data

FeatureDescription
Protein NameUncharacterized protein MG331 homolog
Gene NameMPN_477
OrganismMycoplasma pneumoniae (strain ATCC 29342 / M129)
Amino Acid Sequence Length209 aa
Expression Region1-209
Recombinant ExpressionExpressed in E. coli with N-terminal 10xHis tag and C-terminal Myc tag fusion
PurityGreater than 85% by SDS-PAGE
StorageStore at -20℃, conserve at -20℃ or -80℃ for extended storage; repeated freezing and thawing is not recommended; store working aliquots at 4℃ for up to one week
AA SequenceMGRLEKFRFYRQNDDNNTTVQKALLKAQKQVASWKVELDELSPKILSHYQPFSELSANPV KRKSEPNQVLQSLQTLINNFQTSDFQAIATQADALWLQIKHHDSATGYESWITDDRGMDK IDNLKRFFEDNEQQFIQQTQTFVVQLGNYNKALMALTNEKVSFTTTDLSQPLASSYNPLF KRILLSLLVFFISSLVGLVVLLTLLFTSL

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_477; MP364; P01_orf209; Uncharacterized protein MG331 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_477
Target Protein Sequence
MGRLEKFRFYRQNDDNNTTVQKALLKAQKQVASWKVELDELSPKILSHYQPFSELSANPV KRKSEPNQVLQSLQTLINNFQTSDFQAIATQADALWLQIKHHDSATGYESWITDDRGMDK IDNLKRFFEDNEQQFIQQTQTFVVQLGNYNKALMALTNEKVSFTTTDLSQPLASSYNPLF KRILLSLLVFFISSLVGLVVLLTLLFTSL
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN477

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the recommended methods for recombinant expression of MPN_477?

For optimal expression, we recommend using the pGEX vector system for GST-tagged protein or pET vectors for His-tagged expression in E. coli BL21(DE3). The methodology involves:

  • Transforming the expression plasmid into E. coli BL21(DE3)

  • Inducing protein expression with 0.1-0.6 mM IPTG at 16°C for 12 hours (lower temperature helps with proper folding)

  • Harvesting cells by centrifugation

  • Resuspending cells in PBS buffer with protease inhibitors

  • Lysing cells by sonication

  • Purifying via affinity chromatography (GSH or Ni-NTA columns)

  • Confirming purity by SDS-PAGE and Western blotting

Due to the presence of potential transmembrane domains, consider adding detergents like 0.1% Triton X-100 to improve solubility during purification.

How can I determine if MPN_477 has potential enzymatic activity?

Given the uncharacterized nature of MPN_477, a systematic approach to identifying potential enzymatic functions includes:

  • Sequence-based analysis: Perform BLAST, InterPro, and Pfam searches to identify conserved domains or motifs that might suggest enzymatic function.

  • Structural prediction: Use tools like AlphaFold2 or RoseTTAFold to predict the 3D structure, which may reveal catalytic sites.

  • Activity screening: Test the purified recombinant protein against a panel of common substrates for:

    • ADP-ribosyltransferase activity (relevant in M. pneumoniae pathogenesis)

    • Nuclease activity (test against ssDNA, dsDNA, and RNA substrates)

    • Protease activity (using fluorescent substrates)

    • Glycosidase activity

  • Metal dependency testing: Test activity in the presence of various metals (Mg²⁺, Ca²⁺, Zn²⁺, Mn²⁺), as many M. pneumoniae enzymes show metal dependence .

How do I investigate potential protein-protein interactions of MPN_477?

To identify binding partners of MPN_477, implement these methodologies:

  • GST pull-down assays: Express GST-tagged MPN_477 and incubate with M. pneumoniae whole cell lysates. After washing, analyze bound proteins by:

    • SDS-PAGE with silver staining

    • Mass spectrometry for protein identification

    • Western blotting with antibodies against suspected binding partners

  • Yeast two-hybrid screening: Use MPN_477 as bait against a library of M. pneumoniae proteins to identify interactors.

  • Co-immunoprecipitation: Generate antibodies against MPN_477 and use them to pull down protein complexes from M. pneumoniae lysates.

  • Crosslinking studies: Use chemical crosslinkers to stabilize transient interactions before immunoprecipitation.

  • Bacterial two-hybrid system: Consider this alternative if yeast-based systems prove difficult.

What methods should I use to determine the cellular localization of MPN_477?

Determining the subcellular localization of MPN_477 requires multiple complementary approaches:

  • Immunofluorescence microscopy:

    • Generate specific antibodies against purified recombinant MPN_477

    • Fix M. pneumoniae cells using paraformaldehyde (2-4%)

    • Permeabilize with 0.1% Triton X-100

    • Stain with anti-MPN_477 antibodies and fluorescent secondary antibodies

    • Co-stain with markers for cell membrane, adhesion organelles, and nucleoid

  • Subcellular fractionation:

    • Separate M. pneumoniae into cytoplasmic, membrane, and culture supernatant fractions

    • Analyze fractions by Western blotting with anti-MPN_477 antibodies

    • Include controls for known cytoplasmic and membrane proteins

  • Electron microscopy with immunogold labeling:

    • Provides higher resolution localization within the small M. pneumoniae cells

    • Particularly useful for determining if MPN_477 associates with the adhesion organelle

Based on similar studies with other M. pneumoniae proteins, approximately 7% of certain proteins localize to the membrane fraction, with the majority remaining cytoplasmic .

How can I investigate if MPN_477 is secreted or surface-exposed?

To determine if MPN_477 is secreted or surface-exposed:

  • Surface accessibility assays:

    • Treat intact M. pneumoniae cells with proteases (e.g., trypsin, proteinase K)

    • Compare protease-treated and untreated samples by Western blot

    • Surface-exposed proteins will show reduced signals after protease treatment

  • Surface biotinylation:

    • Label intact cells with membrane-impermeable biotinylation reagents

    • Lyse cells and capture biotinylated proteins with streptavidin

    • Identify MPN_477 by Western blotting

  • Culture supernatant analysis:

    • Concentrate culture supernatants using TCA precipitation or filtration

    • Detect secreted proteins by Western blotting

    • Note: Studies of some M. pneumoniae proteins show they remain cell-associated rather than being released into culture media

  • Flow cytometry analysis:

    • Label intact cells with anti-MPN_477 antibodies and fluorescent secondary antibodies

    • Analyze by flow cytometry to quantify surface exposure

What approaches can I use to investigate MPN_477's role in M. pneumoniae pathogenesis?

To explore potential roles in pathogenesis:

  • Host cell interaction studies:

    • Expose human respiratory epithelial cells to purified MPN_477

    • Assess cytopathic effects, including vacuolization and cell death

    • Measure changes in host cell morphology, viability, and signaling pathways

    • Compare effects to known M. pneumoniae virulence factors like CARDS toxin

  • RNA-seq analysis:

    • Compare gene expression in macrophages or epithelial cells exposed to wild-type M. pneumoniae versus MPN_477-depleted strains

    • Identify host genes specifically regulated in response to MPN_477

  • Animal models:

    • Administer purified MPN_477 to mouse respiratory tracts

    • Assess inflammatory responses, tissue damage, and immune activation

    • Compare histopathological changes to those caused by M. pneumoniae infection

  • Seroconversion studies:

    • Test sera from patients with confirmed M. pneumoniae pneumonia for antibodies against MPN_477

    • Strong seroconversion would suggest in vivo expression and immunogenicity, similar to findings with the CARDS toxin

How can I determine if MPN_477 plays a role in immune evasion mechanisms?

M. pneumoniae employs several immune evasion strategies. To investigate MPN_477's potential role:

  • Sequence variation analysis:

    • Sequence MPN_477 from multiple clinical isolates

    • Identify polymorphisms and assess their distribution

    • Compare to known variable proteins like P1, P40, and P90 that show evidence of antigenic variation

  • RecA-mediated recombination assessment:

    • Determine if MPN_477 undergoes recombination with repetitive elements (RepMP)

    • Analyze if sequence variation is consistent with gene conversion mechanisms

    • Examine if MPN_477 variation correlates with RecA activity

  • NET degradation assays:

    • Test if MPN_477 possesses nuclease activity against neutrophil extracellular traps

    • Compare to known nucleases like MPN491 that degrade NETs to evade immune responses

  • Oxidative stress resistance:

    • Determine if MPN_477 contributes to resistance against ROS

    • Test MPN_477-depleted strains for increased sensitivity to oxidative damage

    • Compare to known antioxidant enzymes like MPN668

What methodologies can I use to create and validate MPN_477 knockout or depletion strains?

Creating genetic modifications in M. pneumoniae is challenging but possible:

  • Transposon mutagenesis approach:

    • Use Tn4001 or mini-transposon systems to create insertional mutants

    • Screen for insertions in the MPN_477 gene

    • Verify disruption by PCR and sequencing

    • Confirm absence of protein by Western blotting

  • CRISPR-Cas9 system adaptation:

    • Design guide RNAs targeting MPN_477

    • Introduce non-homologous end joining (NHEJ) or homology-directed repair (HDR) template

    • Confirm gene knockout by sequencing and Western blotting

  • Antisense RNA approach:

    • Design antisense RNA complementary to MPN_477 mRNA

    • Express antisense RNA under a strong promoter

    • Verify protein depletion by Western blotting

  • Validation of phenotypes:

    • Compare growth rates of wild-type and MPN_477-deficient strains

    • Assess cell morphology by electron microscopy

    • Test ability to adhere to and damage respiratory epithelial cells

    • Evaluate resistance to stress conditions (oxidative, pH, temperature)

How can I investigate if MPN_477 belongs to the UPF0016 family or shows functional similarity to other uncharacterized proteins?

To determine potential relationships to the UPF0016 family or other protein families:

  • Motif analysis:

    • Search for the UPF0016 consensus motif Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr)

    • Conduct multiple sequence alignments with known UPF0016 members

    • Analyze conservation of key residues involved in cation transport

  • Functional complementation:

    • Express MPN_477 in yeast strains lacking specific transporters (e.g., pmr1Δ, smf1Δ)

    • Test for suppression of growth defects under various conditions

    • Compare to known complementation patterns of UPF0016 members

  • Transport assays:

    • Reconstitute purified MPN_477 in liposomes

    • Measure transport of various cations (Mn²⁺, Ca²⁺, etc.)

    • Compare kinetics and selectivity to known UPF0016 transporters

  • Phylogenetic analysis:

    • Construct phylogenetic trees with UPF0016 family members and other uncharacterized proteins

    • Determine evolutionary relationships and potential functional convergence

What control proteins should I include when studying MPN_477 function?

When investigating MPN_477, include these controls:

  • Negative controls:

    • GST or His-tag alone for pulldown experiments

    • Unrelated M. pneumoniae proteins of similar size/structure

    • Heat-denatured MPN_477 for activity assays

  • Positive controls:

    • Known ADP-ribosyltransferases like CARDS toxin (MPN372) for toxicity studies

    • Well-characterized M. pneumoniae membrane proteins for localization studies

    • RecA protein (MPN490) for DNA-binding studies

    • Known virulence factors for pathogenesis studies

  • Internal validation controls:

    • Site-directed mutants of MPN_477 with alterations in predicted functional domains

    • Truncated versions to map functional regions

    • Chimeric proteins combining domains from MPN_477 with well-characterized proteins

How should I design experiments to determine if MPN_477 contributes to M. pneumoniae virulence in cell culture models?

A comprehensive experimental design would include:

  • Experimental groups:

    • Untreated cells (negative control)

    • Cells exposed to wild-type M. pneumoniae

    • Cells exposed to MPN_477-depleted M. pneumoniae

    • Cells exposed to purified recombinant MPN_477

    • Cells exposed to purified MPN_477 with point mutations in key residues

  • Cell types to test:

    • Human bronchial epithelial cells (primary and cell lines)

    • Alveolar epithelial cells

    • Macrophages (RAW264.7 or primary)

    • Tracheal organ cultures (for advanced 3D models)

  • Parameters to measure:

    • Cytopathic effects (vacuolization, cell death)

    • Inflammatory cytokine production

    • Adhesion of M. pneumoniae to host cells

    • Host gene expression changes via RNA-seq

    • Reactive oxygen species production

    • Signaling pathway activation

  • Data analysis approach:

    • Use multiple time points (2, 6, 12, 24, 48 hours)

    • Perform at least three biological replicates

    • Apply appropriate statistical tests (ANOVA with post-hoc tests)

    • Consider using multivariate analysis to identify patterns across parameters

Experimental design should follow the methodology established for other M. pneumoniae proteins, such as the CARDS toxin, which showed progressive cytopathic effects in tracheal rings in organ culture .

What are the common challenges in expressing and purifying MPN_477, and how can they be addressed?

Researchers often encounter these challenges when working with M. pneumoniae proteins:

  • Codon usage bias:

    • M. pneumoniae uses the UGA codon for tryptophan rather than as a stop codon

    • Solution: Check if MPN_477 contains UGA codons. If so, use codon-optimized synthesis or specialized expression strains

  • Protein solubility issues:

    • Hydrophobic C-terminal region may cause aggregation

    • Solutions:

      • Express as fusion with solubility-enhancing tags (MBP, SUMO)

      • Use mild detergents (0.1% Triton X-100, 0.5% CHAPS)

      • Lower induction temperature (16°C)

      • Express truncated versions lacking the hydrophobic region

  • Protein stability:

    • Solutions:

      • Add protease inhibitors during purification

      • Include reducing agents (DTT, β-mercaptoethanol)

      • Optimize buffer conditions (pH, salt concentration)

      • Store with 50% glycerol at -20°C for extended stability

  • Functional assays:

    • Challenge: Determining function of an uncharacterized protein

    • Solutions:

      • Test multiple potential activities

      • Include positive controls for each assay

      • Perform sequence and structural analysis to guide functional testing

How can I overcome difficulties in raising specific antibodies against MPN_477?

To generate and validate specific antibodies:

  • Antigen design strategies:

    • Use full-length protein if soluble

    • Select 2-3 peptides from predicted antigenic regions

    • Consider using both N and C-terminal regions to ensure detection

  • Host selection:

    • Rabbits for polyclonal antibodies

    • Mice for monoclonal antibody production

    • Consider different species for primary and secondary antibodies

  • Validation methods:

    • Western blotting against recombinant protein and M. pneumoniae lysates

    • Immunoprecipitation efficiency testing

    • Pre-adsorption with recombinant protein to confirm specificity

    • Testing against MPN_477-depleted strains as negative controls

  • Troubleshooting low immunogenicity:

    • Use stronger adjuvants (complete Freund's followed by incomplete Freund's)

    • Conjugate to carrier proteins like KLH

    • Increase immunization frequency

    • Pool sera from multiple animals

The approach of using recombinant proteins with adjuvants has been successful for other M. pneumoniae proteins, generating strong humoral immune responses suitable for research applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.