Recombinant Mycoplasma pneumoniae Uncharacterized protein MG406 homolog (MPN_605)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Annotation

MPN_605 was identified during genome re-annotation efforts of Mycoplasma pneumoniae, which increased the total annotated protein-coding genes from 677 to 688. Key findings include:

Genomic FeatureDetails
Original classificationHypothetical protein with unknown function
Re-annotation statusRetained as uncharacterized despite extensive revisions
Genomic positionLocated between MP236 and MP237 (MPN605 locus)
Functional predictionNo enzymatic or structural domains identified via homology modeling

The 2000 re-annotation study found that 43% of previously annotated proteins were revised, but MPN_605 remained functionally unassigned .

Recombinant Expression and Purification

Commercial production (Creative BioMart Cat# RFL6660MF) involves:

Expression protocol:

  • Host: E. coli BL21(DE3) or similar strains

  • Tag: His-tag for immobilized metal affinity chromatography (IMAC) purification

  • Quality control: Verified by mass spectrometry and N-terminal sequencing

Reconstitution guidelines:

ParameterRecommendation
SolubilityReconstitute in sterile water (0.1–1.0 mg/mL)
Storage additives5–50% glycerol for long-term stability
StabilityWorking aliquots stable at 4°C for ≤7 days

Diagnostic Development

  • Mycoplasma pneumoniae serodiagnosis increasingly uses recombinant antigens to replace whole-cell extracts, improving specificity .

  • MPN_605 could serve as a candidate antigen in enzyme-linked immunosorbent assays (ELISAs) or CRISPR-based detection systems .

Proteomic Studies

  • Useful for antibody generation to study Mycoplasma-host interactions .

  • Structural analysis may clarify its role in bacterial persistence or immune evasion .

Research Significance and Gaps

  • Hypothetical role: Given Mycoplasma pneumoniae’s reliance on adhesion organelles for pathogenesis , MPN_605 might contribute to host cell binding or intracellular survival mechanisms.

  • Knowledge gaps: No peer-reviewed studies directly investigate MPN_605’s function, highlighting a need for knockout experiments or interactome analyses.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
MPN_605; C12_orf157L; MP237; Uncharacterized protein MG406 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_605
Target Protein Sequence
MYNWTNKKLTKAIALIILVLWLVVLVGILVWALTTQHLKVLYGWLLPFPFVALSVVGLLK LGDFFEKFKHLSKQRVTVFFGSFFVARYLLYLIPVLLAFFIRPQYFHVIATIISTLFFPL LKIVISFAWLPLEYHCKNLISKLNKKHVTTGDSFKRT
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN605

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of MPN_605?

MPN_605 is an uncharacterized protein from Mycoplasma pneumoniae that is homologous to the MG406 protein. It is a full-length protein consisting of 157 amino acids . As a protein from Mycoplasma pneumoniae, it belongs to the Mollicutes class, a group of bacteria with minimal genomes capable of independent life . The protein can be recombinantly expressed with a His-tag in E. coli expression systems to facilitate purification and subsequent characterization studies .

How does MPN_605 relate to other proteins in the Mycoplasma pneumoniae proteome?

While specific interaction data for MPN_605 is limited in current research, Mycoplasma pneumoniae proteins often form functional complexes that compensate for the organism's reduced genome. Similar to how glycolytic enzymes in M. pneumoniae have been shown to interact directly with each other (as demonstrated with enolase serving as a central hub) , MPN_605 may participate in protein-protein interactions that are essential for its biological function. Comprehensive interaction studies using bacterial two-hybrid systems or co-immunoprecipitation approaches would be necessary to elucidate MPN_605's relationship with other proteins in the proteome.

What genomic context surrounds the MPN_605 gene in the Mycoplasma pneumoniae genome?

The genomic context of MPN_605 should be analyzed within the framework of M. pneumoniae's genome organization. M. pneumoniae has undergone reductive evolution resulting in a minimal genome with limited regulatory features . Recent genomic studies have identified distinct phylogenetic clades in M. pneumoniae (T1-1, T1-2, T1-3, T2-1, and T2-2), which provide important context for understanding gene conservation and variation . Of particular interest, researchers have identified recombination blocks containing multiple genes in M. pneumoniae (such as MPN366-371) , suggesting that analysis of MPN_605's genomic neighborhood could provide insights into its evolutionary history and functional relationships.

What are the optimal conditions for recombinant expression of MPN_605?

  • Codon optimization: M. pneumoniae has different codon usage patterns compared to E. coli, which may affect translation efficiency. Analysis of the MPN_605 sequence for rare codons and potential optimization would be beneficial.

  • Protein solubility assessment: Hydrophobicity analysis of MPN_605 should be performed to predict potential solubility issues. If the protein is too hydrophobic, expression conditions may need adjustment or fusion partners might be required .

  • Translation initiation optimization: To ensure proper production of full-length MPN_605, vectors with fusion tags on both N and C termini can help distinguish full-length products from truncated versions. Increasing imidazole concentration during elution can also help isolate full-length proteins .

  • Expression temperature and induction parameters: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the solubility of recombinant proteins.

What purification strategies are most effective for obtaining high-purity MPN_605 for functional studies?

A multi-step purification strategy is recommended for obtaining high-purity MPN_605:

  • Initial affinity chromatography: Utilize the His-tag for immobilized metal affinity chromatography (IMAC) with gradual imidazole elution to separate full-length MPN_605 from truncated products .

  • Secondary purification: Depending on experimental requirements, size exclusion chromatography (SEC) can be employed to achieve higher purity and verify the oligomeric state of MPN_605.

  • Quality control assessment: SDS-PAGE, western blotting, and mass spectrometry should be used to confirm protein identity, purity, and integrity.

  • Stability optimization: Buffer screening to identify conditions that maintain protein stability during storage is essential, particularly for uncharacterized proteins where optimal conditions may not be known.

How can researchers address challenges in obtaining correctly folded MPN_605?

Ensuring proper folding of recombinant MPN_605 requires several considerations:

  • Chaperone co-expression: E. coli strains engineered to overexpress chaperones can assist in proper folding of the recombinant protein.

  • Refolding protocols: If MPN_605 forms inclusion bodies, systematic refolding screens using various buffer systems, redox conditions, and additives may be necessary.

  • Circular dichroism (CD) spectroscopy: This technique should be employed to verify secondary structure content and proper folding.

  • Functional assays: Development of activity assays, even if preliminary, can help verify that the purified protein retains functionality, indicating proper folding.

What methods are most appropriate for determining the function of an uncharacterized protein like MPN_605?

Multiple complementary approaches should be employed to determine the function of MPN_605:

  • Bioinformatic analysis: Sequence comparison with proteins of known function, domain prediction, and structural modeling can provide initial hypotheses about function.

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, pull-down assays, and co-immunoprecipitation can identify interaction partners that may suggest functional pathways. For example, similar studies with glycolytic enzymes in M. pneumoniae revealed that the enolase functions as a central enzyme interacting with all other glycolytic enzymes .

  • Post-translational modification analysis: Given the importance of protein phosphorylation in M. pneumoniae (such as the HPr kinase system) , phosphoproteomic analysis should be conducted to determine if MPN_605 undergoes phosphorylation or other modifications.

  • Phenotypic analysis of gene knockouts: Generation of MPN_605 knockout strains, if possible, followed by comprehensive phenotypic characterization similar to studies done with glycerophosphodiesterases in M. pneumoniae .

  • Transcriptomic and proteomic analysis: Comparing wild-type and knockout strains to identify genes and proteins with altered expression levels, potentially revealing pathways involving MPN_605.

How can researchers investigate potential regulatory roles of MPN_605 in M. pneumoniae?

Investigation of regulatory roles requires specialized approaches:

  • ChIP-seq or similar techniques: If MPN_605 is suspected to have DNA-binding properties, chromatin immunoprecipitation followed by sequencing can identify potential binding sites.

  • Regulatory element analysis: Search for conserved motifs in promoter regions of genes potentially regulated by MPN_605, similar to how GlpQ-dependent regulation was associated with a conserved cis-acting element in M. pneumoniae .

  • Protein-RNA interaction studies: If regulatory functions involve RNA binding, techniques such as CLIP-seq (cross-linking immunoprecipitation followed by sequencing) can identify target RNAs.

  • Metabolomic analysis: Comparing metabolite profiles between wild-type and MPN_605 mutant strains may reveal metabolic pathways influenced by this protein.

What strategies can be employed to study MPN_605's potential role in M. pneumoniae pathogenicity?

Given the importance of various proteins in M. pneumoniae pathogenicity, several approaches can assess MPN_605's potential role:

  • Adherence assays: Since adhesion to host cells is critical for M. pneumoniae pathogenicity, experiments comparing wild-type and MPN_605 mutant strains' ability to adhere to human respiratory epithelial cells should be performed. This approach is similar to studies with the PrkC kinase, where mutation resulted in non-adherent growth and loss of cytotoxicity toward HeLa cells .

  • Cytotoxicity assays: Using cell lines such as HeLa cells to measure cytotoxic effects, as was done with GlpQ studies in M. pneumoniae .

  • Hydrogen peroxide production measurement: Many M. pneumoniae virulence mechanisms involve hydrogen peroxide production, which should be measured in wild-type versus MPN_605 mutant strains .

  • Immunological response assessment: Evaluating whether MPN_605 elicits specific immune responses in patients infected with M. pneumoniae.

What techniques should be prioritized for structural determination of MPN_605?

A multi-technique approach is recommended for structural characterization:

How can structural information be used to infer function for MPN_605?

Structural data can provide functional insights through several approaches:

  • Structural homology detection: Comparison of the MPN_605 structure with proteins of known function in structural databases might reveal similarities not detectable at the sequence level.

  • Active site identification: Analysis of surface pockets, conserved residues, and electrostatic properties can identify potential catalytic sites or binding pockets.

  • Molecular docking simulations: Computational screening of potential ligands or substrates based on the structure can suggest possible biochemical functions.

  • Structure-guided mutagenesis: Identification of key residues for site-directed mutagenesis to test their importance for function.

How conserved is MPN_605 across different Mycoplasma species and strains?

Conservation analysis should consider several aspects:

  • Phylogenetic distribution: Comparison across the five identified M. pneumoniae clades (T1-1, T1-2, T1-3, T2-1, and T2-2) to determine conservation patterns .

  • Sequence variation analysis: Assessment of synonymous and non-synonymous substitution rates to identify regions under selective pressure.

  • Recombination analysis: Determination of whether MPN_605 falls within recombination hotspots, similar to the identified recombination block containing MPN366-371 .

  • Comparative genomics across Mollicutes: Identification of homologs in related species to understand evolutionary trajectory and potential functional conservation.

What can evolutionary analysis tell us about the potential function of MPN_605?

Evolutionary analysis can provide functional insights through:

  • Co-evolution patterns: Identification of genes that co-evolve with MPN_605 might indicate functional relationships or participation in the same biological processes.

  • Selective pressure analysis: Determining whether MPN_605 is under purifying selection (suggesting important functional constraints) or positive selection (indicating adaptation).

  • Phylogenetic profiling: Correlation of the presence/absence of MPN_605 homologs with specific phenotypes across different species.

  • Synteny analysis: Examination of gene neighborhood conservation patterns across species, which might indicate functional relationships.

How might MPN_605 be involved in post-translational regulatory networks in M. pneumoniae?

Given the importance of post-translational regulation in M. pneumoniae as a compensation for limited transcriptional regulation , several approaches can explore MPN_605's potential role:

  • Phosphoproteomic analysis: Determination of whether MPN_605 undergoes phosphorylation under different conditions, similar to the comprehensive phosphoproteome analysis performed for M. pneumoniae .

  • Interaction with regulatory kinases: Assessment of potential interactions with the known serine/threonine kinases in M. pneumoniae (HPrK and PrkC) .

  • Effect on global phosphorylation patterns: Comparison of the phosphoproteome in wild-type versus MPN_605 mutant strains to identify potential regulatory effects.

  • Other post-translational modifications: Investigation of acetylation, methylation, or other modifications that might regulate MPN_605 activity.

What approaches can be used to study MPN_605 in the context of minimal genome organization and synthetic biology?

As a protein from an organism with one of the smallest genomes capable of independent life , MPN_605 research has implications for minimal genome studies:

  • Essentiality assessment: Determination of whether MPN_605 is part of the minimal essential gene set of M. pneumoniae using transposon mutagenesis or CRISPR-based approaches.

  • Synthetic biology applications: Evaluation of whether MPN_605 should be included in synthetic minimal genome designs based on Mycoplasma blueprints.

  • Functional replacement studies: Testing whether homologs from other organisms can complement MPN_605 function, providing insights into functional constraints.

  • Systems biology integration: Placement of MPN_605 within the context of genome-scale metabolic and regulatory models of M. pneumoniae.

How can cross-disciplinary approaches enhance our understanding of MPN_605's role in M. pneumoniae biology?

Integration of multiple research disciplines can provide comprehensive insights:

  • Structural biology and biophysics: Detailed characterization of MPN_605's structure and dynamics.

  • Systems biology: Integration of MPN_605 data into comprehensive models of M. pneumoniae cellular processes.

  • Synthetic biology: Testing MPN_605 function in reconstituted systems or minimal cells.

  • Clinical microbiology: Correlation of MPN_605 sequence variants with clinical outcomes in M. pneumoniae infections.

  • Immunology: Investigation of potential interactions between MPN_605 and host immune components.

What control experiments are essential when studying an uncharacterized protein like MPN_605?

Rigorous experimental design should include:

  • Protein quality controls: Verification of protein purity, integrity, and correct folding before functional assays.

  • Expression system controls: Comparison with host cells expressing empty vector to account for background effects.

  • Functional assay controls: Inclusion of related proteins with known functions as positive controls and unrelated proteins as negative controls.

  • Genetic manipulation controls: In knockout studies, complementation with the wild-type gene to confirm phenotypes are specifically due to MPN_605 deletion.

  • Specificity controls: For interaction studies, demonstration that observed interactions are specific rather than non-specific binding.

How should researchers approach contradictory findings in MPN_605 characterization?

When contradictory results arise, a systematic approach is necessary:

  • Methodological validation: Verification that different methods used to study MPN_605 are properly calibrated and controlled.

  • Condition-dependent effects: Exploration of whether contradictions result from different experimental conditions, suggesting condition-specific functions.

  • Isoform or modification analysis: Investigation of whether contradictions result from different protein isoforms or post-translational modifications.

  • Multi-laboratory validation: Collaboration with other research groups to independently verify key findings using standardized protocols.

  • Integrated data analysis: Application of statistical and computational methods to reconcile apparently contradictory data within a unified model.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.