Recombinant Mycoplasma pneumoniae Uncharacterized protein MG456 homolog (MPN_670) is a recombinant protein derived from the bacterium Mycoplasma pneumoniae. This protein is expressed in Escherichia coli and is fused with an N-terminal His tag for easier purification and identification. The protein consists of 345 amino acids and is available in a lyophilized powder form .
The following table summarizes the key characteristics of the recombinant protein:
| Characteristic | Description |
|---|---|
| Species | Mycoplasma pneumoniae |
| Source | Escherichia coli |
| Tag | N-terminal His tag |
| Protein Length | Full Length (1-345 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Applications | SDS-PAGE |
The amino acid sequence of the recombinant protein is as follows:
MPELTRFQKFFLTPEKFNKFTRVVGFCGVFALIALSLGIYSYVGQGSIVPKVAALFLIAL GGFTLLLSFVINFVALYKRSQLIHLVNRQDRTDLWLQKMANNKQFEQFELFEKGPISADI LPTFYPATIYNFELVPKQFKVQYKNGQTLNFAKLSAIKRSTSKNEKVACLVAIIDAVSDQ HWFLTKSDFPLINTGFYESLTESNRQNNVLLYTEKDASFNFNQLDKEMIKQVLFNPVNVY ANFNVYNNTTHTYLMMSVPITFMDTSLRMEEAVGDLELNITRQAGYDAATLDSFHKVVEL LKTKLIGDFNNAETTSATETTVVAEVTEPTTNSKRKPVKAKKAKK .
KEGG: mpn:MPN670
MPN_670 is an uncharacterized protein from Mycoplasma pneumoniae that is homologous to the MG456 protein found in Mycoplasma genitalium. It belongs to a class of proteins that have been sequenced but whose functions remain poorly understood. The protein consists of 345 amino acids and is part of the minimal genome of Mycoplasma pneumoniae, one of the smallest known self-replicating organisms .
Similar to other uncharacterized proteins in minimal genomes, MPN_670 likely plays an essential role in cellular function despite our limited understanding of its specific activities. Structurally, it may belong to a class of proteins that exhibit unusual biophysical properties compared to typical globular proteins, potentially including being partially unstructured or having atypical thermodynamic properties, as observed in similar proteins from Mycoplasma genitalium .
Based on current research protocols, E. coli expression systems have proven most effective for producing recombinant MPN_670. The protein is typically expressed with a histidine tag to facilitate purification . When designing your expression system, consider the following methodology:
Select an appropriate E. coli strain (BL21(DE3) or similar expression strains)
Design expression vectors containing the MPN_670 sequence with a His-tag
Optimize codon usage for E. coli expression
Test expression conditions at various temperatures (16°C, 25°C, 37°C)
Test induction with different IPTG concentrations (0.1-1.0 mM)
Expression in mammalian or insect cell systems may be considered if proper folding is an issue, though these approaches require more complex methodology and resources. Initial quality assessment should include SDS-PAGE analysis followed by Western blotting to confirm identity and expression levels.
The primary limitation in understanding MPN_670's structure-function relationships stems from its classification as an uncharacterized protein. Like many proteins identified through genomic sequencing, its three-dimensional structure and biochemical activities remain largely unknown.
Current research challenges include:
Absence of resolved crystal or NMR structures
Limited identification of functional domains or motifs
Incomplete characterization of post-translational modifications
Unknown binding partners in vivo
Unclear evolutionary conservation patterns beyond mycoplasma species
Similar uncharacterized proteins from Mycoplasma genitalium have shown a wide spectrum of structural characteristics, "varying from highly helical to partially structured to unfolded or random coil" . This structural diversity suggests that MPN_670 may not conform to traditional structure-function paradigms, potentially exhibiting context-dependent folding or functioning as part of larger protein complexes.
Circular dichroism represents a powerful first-line technique for rapidly assessing MPN_670's secondary structure and stability characteristics. Based on approaches used with similar mycoplasma proteins, the following methodological protocol is recommended:
Sample preparation:
Purify MPN_670 to >95% homogeneity using affinity chromatography
Dialyze against CD-compatible buffers (10-20 mM phosphate, pH 7.4)
Adjust protein concentration to 0.1-0.5 mg/ml for far-UV measurements
Data collection parameters:
Far-UV CD spectra (190-260 nm) for secondary structure assessment
Near-UV CD spectra (250-350 nm) for tertiary structure fingerprinting
Temperature scans (20-90°C) to assess thermal stability
Analysis approach:
Apply deconvolution algorithms (SELCON3, CDSSTR, CONTINLL) to estimate secondary structure content
Compare thermal denaturation profiles to determine if unfolding is cooperative or non-cooperative
Assess buffer and pH effects to identify optimal stability conditions
This methodological approach has proven effective in characterizing other uncharacterized proteins from mycoplasma species, revealing that some exhibit "cooperative unfolding" while others show "no detectable unfolding upon thermal denaturation" . The CD data should be interpreted in conjunction with other structural techniques for comprehensive characterization.
A multi-step purification strategy is recommended to obtain research-grade MPN_670. Based on established protocols for similar mycoplasma proteins, the following methodology provides optimal results:
Initial capture:
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole
Elution with imidazole gradient (50-250 mM)
Intermediate purification:
Ion exchange chromatography (determine appropriate resin based on isoelectric point)
Buffer exchange using dialysis or desalting column
Polishing step:
Size exclusion chromatography (Superdex 75/200 depending on oligomeric state)
Running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl
Quality control assessment:
SDS-PAGE analysis (>95% purity)
Western blot confirmation
Dynamic light scattering for homogeneity evaluation
Mass spectrometry for intact mass verification
This approach typically yields 2-5 mg of purified protein per liter of E. coli culture. When assessing functional activity, researchers should consider developing activity assays based on predicted functions or interaction partners, as standard activity assays may not be applicable to this uncharacterized protein .
To identify MPN_670's functional partners, a multi-faceted approach combining both in vitro and in vivo methods is recommended. The following methodological framework should be implemented:
Affinity-based approaches:
Pull-down assays using His-tagged MPN_670 as bait
Co-immunoprecipitation with antibodies against MPN_670
Crosslinking mass spectrometry to capture transient interactions
Library screening methods:
Yeast two-hybrid screening against a Mycoplasma pneumoniae library
Phage display to identify peptide binding motifs
Protein microarray screening
Proximity-based in vivo techniques:
BioID or TurboID proximity labeling in heterologous expression systems
FRET/BRET assays for candidate interactions
In-cell NMR when feasible
Computational prediction and validation:
Use of interactome prediction algorithms
Structural modeling of potential complexes
Conservation-based analyses across mycoplasma species
All potential interactions should be verified through reciprocal experiments and functional assays. The interacting protein data can provide crucial insights into biological pathways involving MPN_670, helping to elucidate its function in the minimal Mycoplasma pneumoniae genome .
The statistical analysis of MPN_670 experimental data should be tailored to the specific experimental design while adhering to best practices in biophysical and biochemical data analysis. The following methodological framework is recommended:
Initial data analysis:
Assess data quality through descriptive statistics (mean, standard deviation, median)
Check for normality using skewness, kurtosis, and frequency histograms
Identify outliers using statistical tests rather than arbitrary cutoffs
Evaluate measurement quality through methods such as Cronbach's alpha for internal consistency
Appropriate statistical tests:
For comparing expression conditions: ANOVA with post-hoc tests
For binding studies: nonlinear regression for Kd determination
For structural comparisons: hierarchical clustering or principal component analysis
For thermal stability: sigmoidal curve fitting for Tm calculation
Validation approaches:
When dealing with complex, non-linear phenomena often encountered in protein characterization studies, consider implementing "nonlinear analysis" techniques that can detect "bifurcations, chaos, harmonics and subharmonics that cannot be analyzed using simple linear methods" .
When confronted with contradictory results in MPN_670 studies, a systematic analytical approach should be implemented:
Source identification:
Evaluate methodological differences between studies (expression systems, tags, buffers)
Assess protein quality metrics (purity, aggregation state, post-translational modifications)
Consider environmental variables (temperature, pH, salt concentration)
Examine data analysis approaches for systematic biases
Resolution strategies:
Design controlled experiments specifically addressing the contradictions
Employ orthogonal techniques to verify key findings
Collaborate with laboratories reporting different results
Consider protein batch effects and reagent variability
Comprehensive reporting framework:
Document all experimental conditions comprehensively
Report negative and inconclusive results
Provide raw data where possible
Contextualize findings within the broader literature
Advanced reconciliation approaches:
Meta-analysis of available data when sufficient studies exist
Structural modeling to propose mechanism-based explanations
Molecular dynamics simulations to explore conformational plasticity
When analyzing contradictory data, researchers should apply both exploratory and confirmatory approaches depending on the stage of research, while being cautious about multiple testing issues. As noted in statistical best practices, "when testing multiple models at once there is a high chance on finding at least one of them to be significant, but this can be due to a type 1 error" .
A comprehensive bioinformatic analysis of MPN_670 requires leveraging multiple computational tools and databases. The following methodological approach is recommended:
Sequence-based analyses:
BLAST/PSI-BLAST for homology identification
HMMER for remote homology detection using profile HMMs
InterProScan for functional domain recognition
SignalP/TMHMM for cellular localization prediction
Structural prediction tools:
AlphaFold/RoseTTAFold for 3D structure prediction
PSIPRED for secondary structure prediction
FoldIndex for prediction of intrinsically disordered regions
ConSurf for evolutionary conservation mapping
Specialized mycoplasma resources:
MycoCyc for mycoplasma-specific pathway information
MycoBase for comparative genomics across mycoplasma species
Minimal genome databases for essential gene identification
Integrated analysis pipelines:
Gene neighborhood analysis to identify functional associations
Co-expression data mining from transcriptomic studies
Metabolic network analysis within the minimal genome context
When analyzing MPN_670, consider that it may belong to a class of proteins that "differ significantly from typical globular proteins," potentially being "unstructured in the absence of a 'partner' molecule" or exhibiting "unusual thermodynamic properties" . This characteristic has been observed in other uncharacterized proteins from mycoplasma species and may require specialized analysis approaches.
Structural genomics approaches offer powerful methodologies for elucidating MPN_670's function, especially given its status as an uncharacterized protein. The following comprehensive strategy is recommended:
High-throughput structural determination pipeline:
Parallel construct design with varying domain boundaries and fusion partners
Expression screening in multiple systems (bacterial, eukaryotic)
Automated purification optimization
Crystallization or NMR sample preparation condition matrix screening
Integrated structural analysis:
X-ray crystallography for atomic resolution structures
Cryo-EM for complexes and difficult-to-crystallize forms
NMR for dynamic regions and ligand binding studies
Small-angle X-ray scattering (SAXS) for solution conformation
Structure-guided functional annotation:
Structural comparison with characterized proteins using DALI/VAST
Active site prediction and conservation analysis
Virtual ligand screening against potential binding pockets
Molecular dynamics simulations to identify functionally relevant conformational states
This approach aligns with established structural genomics methodologies that have successfully characterized other "proteins that differed significantly from typical globular proteins" within minimal genomes . When applying these techniques to MPN_670, researchers should be prepared for challenges similar to those encountered with other mycoplasma proteins, including potential structural disorder or partner-dependent folding.
The conservation of MPN_670 across mycoplasma species provides valuable insights into minimal genome research and essential protein function. Consider the following analytical framework:
Evolutionary significance analysis:
Phylogenetic profiling across mycoplasma species and beyond
Selection pressure analysis (dN/dS ratios) to identify functional constraints
Identification of conserved motifs versus variable regions
Correlation with genome reduction patterns in minimal genomes
Functional implication assessment:
Correlation between MPN_670 conservation and organism lifecycle requirements
Comparative analysis with known essential genes in minimal genomes
Identification of co-conserved gene clusters suggesting functional relationships
Analysis of conservation patterns in relation to ecological niches
Experimental validation approaches:
Gene knockout/knockdown attempts to determine essentiality
Complementation studies across species to test functional conservation
Domain swapping experiments to identify critical functional regions
Minimal fragment identification for functional sufficiency
The observation that some uncharacterized proteins in minimal genomes are "highly conserved from mycoplasma to man" suggests MPN_670 may belong to a class of proteins with fundamental biological importance despite our limited understanding of their specific functions. This conservation pattern provides a strong rationale for continued investigation into MPN_670's role in cellular processes.
Protein moonlighting refers to proteins that perform multiple functions, often in different cellular locations or contexts. To investigate potential moonlighting functions of MPN_670, the following experimental design methodology is recommended:
Subcellular localization studies:
Immunofluorescence microscopy under various growth conditions
Cell fractionation followed by Western blotting
Proximity labeling approaches to identify location-specific interaction partners
Live-cell imaging with fluorescently tagged MPN_670
Condition-dependent functional assays:
Activity screening under different physiological conditions (pH, redox state)
Testing function during different growth phases
Stress response analysis (heat shock, nutrient limitation)
Host-pathogen interaction contexts
Structure-function relationship approaches:
Domain deletion analysis to map functional regions
Site-directed mutagenesis of predicted functional residues
Conformational state analysis using limited proteolysis
Ligand binding screens with metabolite libraries
Systems biology integration:
Transcriptomic analysis of MPN_670 knockdown/overexpression
Metabolomic profiling to identify affected pathways
Network analysis to position MPN_670 in multiple cellular processes
Comparative analysis with known moonlighting proteins
This comprehensive approach addresses the possibility that MPN_670, like other proteins in minimal genomes, may have evolved multiple functions as an adaptation to genome reduction. The diversity of structural properties observed in mycoplasma proteins, "ranging from cooperative unfolding to no detectable unfolding upon thermal denaturation" , suggests potential structural plasticity that could support moonlighting functions.
A comprehensive comparative analysis of MPN_670 with proteins from other minimal genome organisms provides important contextual understanding. The following analytical framework should be applied:
Structural comparison methodology:
Alignment with homologs from other minimal genome bacteria
Comparison of predicted secondary structure elements
Analysis of conservation patterns in intrinsically disordered regions
Evaluation of thermodynamic stability profiles across related proteins
Functional context analysis:
Genomic context comparison across minimal genomes
Assessment of essentiality in different minimal genome organisms
Comparison of expression patterns under similar conditions
Analysis of post-translational modifications across species
Evolutionary perspective:
Reconstruction of ancestral sequences
Identification of convergent/divergent evolutionary patterns
Analysis of selection pressures in different lineages
Assessment of horizontal gene transfer events
These comparisons should consider that MPN_670 may belong to a category of proteins that differ significantly from typical globular proteins, potentially exhibiting unusual folding properties or requiring binding partners for stability . The comparative approach can reveal whether these characteristics are conserved across minimal genome organisms, providing insights into fundamental principles of protein evolution under genome reduction pressure.
| Organism | Genome Size | Protein Homolog | Sequence Identity | Predicted Structure | Known Function |
|---|---|---|---|---|---|
| M. pneumoniae | 816 kb | MPN_670 | 100% | Undetermined | Uncharacterized |
| M. genitalium | 580 kb | MG456 | High | Varies from helical to partially structured | Uncharacterized |
| M. mobile | 777 kb | MMOB_nnnn* | Moderate | Undetermined | Uncharacterized |
| M. hyopneumoniae | 893 kb | MHJ_nnnn* | Low | Undetermined | Uncharacterized |
*Specific locus tags would need to be determined through detailed sequence analysis
Researching uncharacterized proteins in minimal genomes presents distinct methodological challenges that require specialized approaches:
Expression and purification challenges:
Potential toxicity in heterologous expression systems
Improper folding due to missing chaperones or cofactors
Stability issues during purification
Low expression yields
Solution behavior that differs from typical globular proteins
Functional annotation difficulties:
Limited homology to characterized proteins
Absence of recognizable functional domains
Potential moonlighting functions not predicted by sequence
Context-dependent activity requiring specific partners
Lack of standard assays for novel functions
Structural analysis complexities:
Intrinsic disorder or partial folding
Crystallization difficulties
Conformational heterogeneity
Partner-dependent folding
Unusual thermodynamic properties
Methodological adaptations:
Co-expression with potential partners
Stability enhancement through fusion partners or stabilizing mutations
Use of complementary structural techniques (CD, SAXS, NMR)
Development of custom activity assays
Integration of computational and experimental approaches
When studying MPN_670, researchers should consider that similar proteins from minimal genomes have shown diverse structural characteristics, with some exhibiting cooperative unfolding while others show no detectable unfolding upon thermal denaturation . These unusual properties necessitate adaptations to standard research protocols.
Integrating MPN_670 research into systems biology frameworks requires methodical data collection and contextual analysis. The following approach is recommended:
Multi-omics data integration:
Transcriptomic analysis to identify co-expressed genes
Proteomic studies to confirm expression and identify post-translational modifications
Metabolomic profiling to detect metabolic changes upon MPN_670 perturbation
Interactomic mapping to position MPN_670 in protein networks
Network analysis methodology:
Construction of protein-protein interaction networks
Pathway enrichment analysis
Topological analysis to identify network position
Boolean network modeling to predict system-wide effects
Genome-scale modeling integration:
Incorporation of MPN_670 into genome-scale metabolic models
Constraint-based modeling to predict phenotypic effects
Flux balance analysis to identify potential metabolic roles
Model refinement based on experimental validation
Comparative systems analysis:
Cross-species comparison of network positions
Evolutionary analysis of system components
Minimal network identification
Essential gene context analysis
This systems biology approach is particularly valuable for uncharacterized proteins in minimal genomes, as their functions may only become apparent when viewed in the context of the entire biological system. The limited genome of Mycoplasma pneumoniae makes it an ideal model for such comprehensive analysis, potentially revealing emergent properties not detectable through isolated protein studies .
To definitively determine MPN_670's function, a multi-faceted research strategy combining cutting-edge techniques is recommended:
CRISPR-based functional genomics:
CRISPRi for conditional knockdown phenotyping
CRISPRa for overexpression studies
CRISPR scanning to identify essential domains
Base editing for point mutation analysis
Advanced structural studies:
Integrative structural biology combining X-ray, NMR, and cryo-EM
Hydrogen-deuterium exchange mass spectrometry for dynamics
Cross-linking mass spectrometry for interaction interfaces
Time-resolved structural analysis during functional cycles
High-resolution interactomics:
Proximity labeling in native conditions
Affinity purification-mass spectrometry with quantitative analysis
Protein complementation assays for direct interactions
Single-molecule interaction studies
Functional reconstitution:
In vitro reconstitution of potential biochemical activities
Cell-free expression systems for functional testing
Minimal synthetic biology approaches
Heterologous complementation in model organisms
These approaches should be implemented with awareness that MPN_670 may belong to a class of proteins with unusual biophysical properties, potentially requiring specialized experimental conditions . The comprehensive strategy allows for convergent validation of function through multiple independent lines of evidence.
Determining the essentiality of MPN_670 requires careful experimental design that accommodates the challenging nature of mycoplasma genetics. The following methodological framework is recommended:
Genetic manipulation approaches:
Transposon mutagenesis followed by deep sequencing (Tn-seq)
CRISPR interference with titratable repression
Antisense RNA knockdown with quantitative phenotyping
Attempted gene deletion with complementation controls
Conditional essentiality testing:
Essentiality assessment across different growth conditions
Nutrient limitation studies
Temperature sensitivity analysis
Host cell interaction contexts
Depletion phenotype characterization:
Growth curve analysis with quantitative metrics
Morphological assessment using advanced microscopy
Metabolic profiling during protein depletion
Transcriptional response to depletion
Comparative essentiality analysis:
Cross-species comparison in different mycoplasma
Correlation with minimal genome studies
Synthetic lethality screening with other genes
Essentiality prediction from network centrality measures
This rigorous approach to essentiality testing provides multiple lines of evidence while accommodating the unique challenges of working with mycoplasma species. The analysis should consider that proteins conserved across minimal genomes often play essential roles, even when their specific functions remain uncharacterized .
While circular dichroism provides valuable initial structural insights, a comprehensive biophysical characterization of MPN_670 requires additional advanced techniques:
Solution-based structural techniques:
Small-angle X-ray scattering (SAXS) for molecular envelope determination
Nuclear magnetic resonance (NMR) for atomic-resolution dynamics
Analytical ultracentrifugation for oligomeric state analysis
Dynamic light scattering for homogeneity assessment
Stability and unfolding analysis:
Differential scanning calorimetry for thermodynamic parameters
Chemical denaturation monitored by fluorescence
Hydrogen-deuterium exchange mass spectrometry for local stability
Limited proteolysis coupled with mass spectrometry
Binding and interaction characterization:
Isothermal titration calorimetry for binding thermodynamics
Surface plasmon resonance for binding kinetics
Microscale thermophoresis for weak interactions
Bio-layer interferometry for real-time binding analysis
Single-molecule techniques:
Förster resonance energy transfer for conformational dynamics
Atomic force microscopy for mechanical properties
Single-molecule pull-down for rare interaction detection
Nanopore analysis for translocation properties