Recombinant Mycoplasma pneumoniae Uncharacterized protein MG456 homolog (MPN_670)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG456 Homolog (MPN_670)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG456 homolog (MPN_670) is a recombinant protein derived from the bacterium Mycoplasma pneumoniae. This protein is expressed in Escherichia coli and is fused with an N-terminal His tag for easier purification and identification. The protein consists of 345 amino acids and is available in a lyophilized powder form .

Characteristics of Recombinant Mycoplasma pneumoniae Uncharacterized Protein MG456 Homolog (MPN_670)

The following table summarizes the key characteristics of the recombinant protein:

CharacteristicDescription
SpeciesMycoplasma pneumoniae
SourceEscherichia coli
TagN-terminal His tag
Protein LengthFull Length (1-345 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE

Amino Acid Sequence

The amino acid sequence of the recombinant protein is as follows:

MPELTRFQKFFLTPEKFNKFTRVVGFCGVFALIALSLGIYSYVGQGSIVPKVAALFLIAL GGFTLLLSFVINFVALYKRSQLIHLVNRQDRTDLWLQKMANNKQFEQFELFEKGPISADI LPTFYPATIYNFELVPKQFKVQYKNGQTLNFAKLSAIKRSTSKNEKVACLVAIIDAVSDQ HWFLTKSDFPLINTGFYESLTESNRQNNVLLYTEKDASFNFNQLDKEMIKQVLFNPVNVY ANFNVYNNTTHTYLMMSVPITFMDTSLRMEEAVGDLELNITRQAGYDAATLDSFHKVVEL LKTKLIGDFNNAETTSATETTVVAEVTEPTTNSKRKPVKAKKAKK .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MPN_670; K05_orf345; MP172; Uncharacterized protein MG456 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_670
Target Protein Sequence
MPELTRFQKFFLTPEKFNKFTRVVGFCGVFALIALSLGIYSYVGQGSIVPKVAALFLIAL GGFTLLLSFVINFVALYKRSQLIHLVNRQDRTDLWLQKMANNKQFEQFELFEKGPISADI LPTFYPATIYNFELVPKQFKVQYKNGQTLNFAKLSAIKRSTSKNEKVACLVAIIDAVSDQ HWFLTKSDFPLINTGFYESLTESNRQNNVLLYTEKDASFNFNQLDKEMIKQVLFNPVNVY ANFNVYNNTTHTYLMMSVPITFMDTSLRMEEAVGDLELNITRQAGYDAATLDSFHKVVEL LKTKLIGDFNNAETTSATETTVVAEVTEPTTNSKRKPVKAKKAKK
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN670

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_670 and how is it classified within the Mycoplasma proteome?

MPN_670 is an uncharacterized protein from Mycoplasma pneumoniae that is homologous to the MG456 protein found in Mycoplasma genitalium. It belongs to a class of proteins that have been sequenced but whose functions remain poorly understood. The protein consists of 345 amino acids and is part of the minimal genome of Mycoplasma pneumoniae, one of the smallest known self-replicating organisms .

Similar to other uncharacterized proteins in minimal genomes, MPN_670 likely plays an essential role in cellular function despite our limited understanding of its specific activities. Structurally, it may belong to a class of proteins that exhibit unusual biophysical properties compared to typical globular proteins, potentially including being partially unstructured or having atypical thermodynamic properties, as observed in similar proteins from Mycoplasma genitalium .

What expression systems are most effective for producing recombinant MPN_670?

Based on current research protocols, E. coli expression systems have proven most effective for producing recombinant MPN_670. The protein is typically expressed with a histidine tag to facilitate purification . When designing your expression system, consider the following methodology:

  • Select an appropriate E. coli strain (BL21(DE3) or similar expression strains)

  • Design expression vectors containing the MPN_670 sequence with a His-tag

  • Optimize codon usage for E. coli expression

  • Test expression conditions at various temperatures (16°C, 25°C, 37°C)

  • Test induction with different IPTG concentrations (0.1-1.0 mM)

Expression in mammalian or insect cell systems may be considered if proper folding is an issue, though these approaches require more complex methodology and resources. Initial quality assessment should include SDS-PAGE analysis followed by Western blotting to confirm identity and expression levels.

What are the current limitations in our understanding of MPN_670's structure-function relationships?

The primary limitation in understanding MPN_670's structure-function relationships stems from its classification as an uncharacterized protein. Like many proteins identified through genomic sequencing, its three-dimensional structure and biochemical activities remain largely unknown.

Current research challenges include:

  • Absence of resolved crystal or NMR structures

  • Limited identification of functional domains or motifs

  • Incomplete characterization of post-translational modifications

  • Unknown binding partners in vivo

  • Unclear evolutionary conservation patterns beyond mycoplasma species

Similar uncharacterized proteins from Mycoplasma genitalium have shown a wide spectrum of structural characteristics, "varying from highly helical to partially structured to unfolded or random coil" . This structural diversity suggests that MPN_670 may not conform to traditional structure-function paradigms, potentially exhibiting context-dependent folding or functioning as part of larger protein complexes.

How should circular dichroism (CD) be optimized for characterizing the secondary structure of MPN_670?

Circular dichroism represents a powerful first-line technique for rapidly assessing MPN_670's secondary structure and stability characteristics. Based on approaches used with similar mycoplasma proteins, the following methodological protocol is recommended:

  • Sample preparation:

    • Purify MPN_670 to >95% homogeneity using affinity chromatography

    • Dialyze against CD-compatible buffers (10-20 mM phosphate, pH 7.4)

    • Adjust protein concentration to 0.1-0.5 mg/ml for far-UV measurements

  • Data collection parameters:

    • Far-UV CD spectra (190-260 nm) for secondary structure assessment

    • Near-UV CD spectra (250-350 nm) for tertiary structure fingerprinting

    • Temperature scans (20-90°C) to assess thermal stability

  • Analysis approach:

    • Apply deconvolution algorithms (SELCON3, CDSSTR, CONTINLL) to estimate secondary structure content

    • Compare thermal denaturation profiles to determine if unfolding is cooperative or non-cooperative

    • Assess buffer and pH effects to identify optimal stability conditions

This methodological approach has proven effective in characterizing other uncharacterized proteins from mycoplasma species, revealing that some exhibit "cooperative unfolding" while others show "no detectable unfolding upon thermal denaturation" . The CD data should be interpreted in conjunction with other structural techniques for comprehensive characterization.

What purification strategy yields the highest purity and activity for recombinant MPN_670?

A multi-step purification strategy is recommended to obtain research-grade MPN_670. Based on established protocols for similar mycoplasma proteins, the following methodology provides optimal results:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Elution with imidazole gradient (50-250 mM)

  • Intermediate purification:

    • Ion exchange chromatography (determine appropriate resin based on isoelectric point)

    • Buffer exchange using dialysis or desalting column

  • Polishing step:

    • Size exclusion chromatography (Superdex 75/200 depending on oligomeric state)

    • Running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl

  • Quality control assessment:

    • SDS-PAGE analysis (>95% purity)

    • Western blot confirmation

    • Dynamic light scattering for homogeneity evaluation

    • Mass spectrometry for intact mass verification

This approach typically yields 2-5 mg of purified protein per liter of E. coli culture. When assessing functional activity, researchers should consider developing activity assays based on predicted functions or interaction partners, as standard activity assays may not be applicable to this uncharacterized protein .

How can protein-protein interaction studies be designed to identify MPN_670's functional partners?

To identify MPN_670's functional partners, a multi-faceted approach combining both in vitro and in vivo methods is recommended. The following methodological framework should be implemented:

  • Affinity-based approaches:

    • Pull-down assays using His-tagged MPN_670 as bait

    • Co-immunoprecipitation with antibodies against MPN_670

    • Crosslinking mass spectrometry to capture transient interactions

  • Library screening methods:

    • Yeast two-hybrid screening against a Mycoplasma pneumoniae library

    • Phage display to identify peptide binding motifs

    • Protein microarray screening

  • Proximity-based in vivo techniques:

    • BioID or TurboID proximity labeling in heterologous expression systems

    • FRET/BRET assays for candidate interactions

    • In-cell NMR when feasible

  • Computational prediction and validation:

    • Use of interactome prediction algorithms

    • Structural modeling of potential complexes

    • Conservation-based analyses across mycoplasma species

All potential interactions should be verified through reciprocal experiments and functional assays. The interacting protein data can provide crucial insights into biological pathways involving MPN_670, helping to elucidate its function in the minimal Mycoplasma pneumoniae genome .

What statistical approaches are most appropriate for analyzing MPN_670 experimental data?

The statistical analysis of MPN_670 experimental data should be tailored to the specific experimental design while adhering to best practices in biophysical and biochemical data analysis. The following methodological framework is recommended:

  • Initial data analysis:

    • Assess data quality through descriptive statistics (mean, standard deviation, median)

    • Check for normality using skewness, kurtosis, and frequency histograms

    • Identify outliers using statistical tests rather than arbitrary cutoffs

    • Evaluate measurement quality through methods such as Cronbach's alpha for internal consistency

  • Appropriate statistical tests:

    • For comparing expression conditions: ANOVA with post-hoc tests

    • For binding studies: nonlinear regression for Kd determination

    • For structural comparisons: hierarchical clustering or principal component analysis

    • For thermal stability: sigmoidal curve fitting for Tm calculation

  • Validation approaches:

    • Cross-validation when developing predictive models

    • Sensitivity analysis to determine how parameter variations affect outcomes

    • Bootstrapping for estimates of confidence intervals

When dealing with complex, non-linear phenomena often encountered in protein characterization studies, consider implementing "nonlinear analysis" techniques that can detect "bifurcations, chaos, harmonics and subharmonics that cannot be analyzed using simple linear methods" .

How should researchers approach contradictory results in MPN_670 characterization studies?

When confronted with contradictory results in MPN_670 studies, a systematic analytical approach should be implemented:

  • Source identification:

    • Evaluate methodological differences between studies (expression systems, tags, buffers)

    • Assess protein quality metrics (purity, aggregation state, post-translational modifications)

    • Consider environmental variables (temperature, pH, salt concentration)

    • Examine data analysis approaches for systematic biases

  • Resolution strategies:

    • Design controlled experiments specifically addressing the contradictions

    • Employ orthogonal techniques to verify key findings

    • Collaborate with laboratories reporting different results

    • Consider protein batch effects and reagent variability

  • Comprehensive reporting framework:

    • Document all experimental conditions comprehensively

    • Report negative and inconclusive results

    • Provide raw data where possible

    • Contextualize findings within the broader literature

  • Advanced reconciliation approaches:

    • Meta-analysis of available data when sufficient studies exist

    • Structural modeling to propose mechanism-based explanations

    • Molecular dynamics simulations to explore conformational plasticity

When analyzing contradictory data, researchers should apply both exploratory and confirmatory approaches depending on the stage of research, while being cautious about multiple testing issues. As noted in statistical best practices, "when testing multiple models at once there is a high chance on finding at least one of them to be significant, but this can be due to a type 1 error" .

What bioinformatic tools and databases are most valuable for predicting MPN_670 function?

A comprehensive bioinformatic analysis of MPN_670 requires leveraging multiple computational tools and databases. The following methodological approach is recommended:

  • Sequence-based analyses:

    • BLAST/PSI-BLAST for homology identification

    • HMMER for remote homology detection using profile HMMs

    • InterProScan for functional domain recognition

    • SignalP/TMHMM for cellular localization prediction

  • Structural prediction tools:

    • AlphaFold/RoseTTAFold for 3D structure prediction

    • PSIPRED for secondary structure prediction

    • FoldIndex for prediction of intrinsically disordered regions

    • ConSurf for evolutionary conservation mapping

  • Specialized mycoplasma resources:

    • MycoCyc for mycoplasma-specific pathway information

    • MycoBase for comparative genomics across mycoplasma species

    • Minimal genome databases for essential gene identification

  • Integrated analysis pipelines:

    • Gene neighborhood analysis to identify functional associations

    • Co-expression data mining from transcriptomic studies

    • Metabolic network analysis within the minimal genome context

When analyzing MPN_670, consider that it may belong to a class of proteins that "differ significantly from typical globular proteins," potentially being "unstructured in the absence of a 'partner' molecule" or exhibiting "unusual thermodynamic properties" . This characteristic has been observed in other uncharacterized proteins from mycoplasma species and may require specialized analysis approaches.

How can structural genomics approaches be applied to understand MPN_670's function?

Structural genomics approaches offer powerful methodologies for elucidating MPN_670's function, especially given its status as an uncharacterized protein. The following comprehensive strategy is recommended:

  • High-throughput structural determination pipeline:

    • Parallel construct design with varying domain boundaries and fusion partners

    • Expression screening in multiple systems (bacterial, eukaryotic)

    • Automated purification optimization

    • Crystallization or NMR sample preparation condition matrix screening

  • Integrated structural analysis:

    • X-ray crystallography for atomic resolution structures

    • Cryo-EM for complexes and difficult-to-crystallize forms

    • NMR for dynamic regions and ligand binding studies

    • Small-angle X-ray scattering (SAXS) for solution conformation

  • Structure-guided functional annotation:

    • Structural comparison with characterized proteins using DALI/VAST

    • Active site prediction and conservation analysis

    • Virtual ligand screening against potential binding pockets

    • Molecular dynamics simulations to identify functionally relevant conformational states

This approach aligns with established structural genomics methodologies that have successfully characterized other "proteins that differed significantly from typical globular proteins" within minimal genomes . When applying these techniques to MPN_670, researchers should be prepared for challenges similar to those encountered with other mycoplasma proteins, including potential structural disorder or partner-dependent folding.

What is the significance of MPN_670 conservation across mycoplasma species for minimal genome research?

The conservation of MPN_670 across mycoplasma species provides valuable insights into minimal genome research and essential protein function. Consider the following analytical framework:

  • Evolutionary significance analysis:

    • Phylogenetic profiling across mycoplasma species and beyond

    • Selection pressure analysis (dN/dS ratios) to identify functional constraints

    • Identification of conserved motifs versus variable regions

    • Correlation with genome reduction patterns in minimal genomes

  • Functional implication assessment:

    • Correlation between MPN_670 conservation and organism lifecycle requirements

    • Comparative analysis with known essential genes in minimal genomes

    • Identification of co-conserved gene clusters suggesting functional relationships

    • Analysis of conservation patterns in relation to ecological niches

  • Experimental validation approaches:

    • Gene knockout/knockdown attempts to determine essentiality

    • Complementation studies across species to test functional conservation

    • Domain swapping experiments to identify critical functional regions

    • Minimal fragment identification for functional sufficiency

The observation that some uncharacterized proteins in minimal genomes are "highly conserved from mycoplasma to man" suggests MPN_670 may belong to a class of proteins with fundamental biological importance despite our limited understanding of their specific functions. This conservation pattern provides a strong rationale for continued investigation into MPN_670's role in cellular processes.

How can researchers design experiments to determine if MPN_670 has moonlighting functions?

Protein moonlighting refers to proteins that perform multiple functions, often in different cellular locations or contexts. To investigate potential moonlighting functions of MPN_670, the following experimental design methodology is recommended:

  • Subcellular localization studies:

    • Immunofluorescence microscopy under various growth conditions

    • Cell fractionation followed by Western blotting

    • Proximity labeling approaches to identify location-specific interaction partners

    • Live-cell imaging with fluorescently tagged MPN_670

  • Condition-dependent functional assays:

    • Activity screening under different physiological conditions (pH, redox state)

    • Testing function during different growth phases

    • Stress response analysis (heat shock, nutrient limitation)

    • Host-pathogen interaction contexts

  • Structure-function relationship approaches:

    • Domain deletion analysis to map functional regions

    • Site-directed mutagenesis of predicted functional residues

    • Conformational state analysis using limited proteolysis

    • Ligand binding screens with metabolite libraries

  • Systems biology integration:

    • Transcriptomic analysis of MPN_670 knockdown/overexpression

    • Metabolomic profiling to identify affected pathways

    • Network analysis to position MPN_670 in multiple cellular processes

    • Comparative analysis with known moonlighting proteins

This comprehensive approach addresses the possibility that MPN_670, like other proteins in minimal genomes, may have evolved multiple functions as an adaptation to genome reduction. The diversity of structural properties observed in mycoplasma proteins, "ranging from cooperative unfolding to no detectable unfolding upon thermal denaturation" , suggests potential structural plasticity that could support moonlighting functions.

How does MPN_670 compare structurally and functionally to characterized proteins in other minimal genome organisms?

A comprehensive comparative analysis of MPN_670 with proteins from other minimal genome organisms provides important contextual understanding. The following analytical framework should be applied:

  • Structural comparison methodology:

    • Alignment with homologs from other minimal genome bacteria

    • Comparison of predicted secondary structure elements

    • Analysis of conservation patterns in intrinsically disordered regions

    • Evaluation of thermodynamic stability profiles across related proteins

  • Functional context analysis:

    • Genomic context comparison across minimal genomes

    • Assessment of essentiality in different minimal genome organisms

    • Comparison of expression patterns under similar conditions

    • Analysis of post-translational modifications across species

  • Evolutionary perspective:

    • Reconstruction of ancestral sequences

    • Identification of convergent/divergent evolutionary patterns

    • Analysis of selection pressures in different lineages

    • Assessment of horizontal gene transfer events

These comparisons should consider that MPN_670 may belong to a category of proteins that differ significantly from typical globular proteins, potentially exhibiting unusual folding properties or requiring binding partners for stability . The comparative approach can reveal whether these characteristics are conserved across minimal genome organisms, providing insights into fundamental principles of protein evolution under genome reduction pressure.

OrganismGenome SizeProtein HomologSequence IdentityPredicted StructureKnown Function
M. pneumoniae816 kbMPN_670100%UndeterminedUncharacterized
M. genitalium580 kbMG456HighVaries from helical to partially structuredUncharacterized
M. mobile777 kbMMOB_nnnn*ModerateUndeterminedUncharacterized
M. hyopneumoniae893 kbMHJ_nnnn*LowUndeterminedUncharacterized

*Specific locus tags would need to be determined through detailed sequence analysis

What methodological challenges are specific to studying uncharacterized proteins like MPN_670 in minimal genomes?

Researching uncharacterized proteins in minimal genomes presents distinct methodological challenges that require specialized approaches:

  • Expression and purification challenges:

    • Potential toxicity in heterologous expression systems

    • Improper folding due to missing chaperones or cofactors

    • Stability issues during purification

    • Low expression yields

    • Solution behavior that differs from typical globular proteins

  • Functional annotation difficulties:

    • Limited homology to characterized proteins

    • Absence of recognizable functional domains

    • Potential moonlighting functions not predicted by sequence

    • Context-dependent activity requiring specific partners

    • Lack of standard assays for novel functions

  • Structural analysis complexities:

    • Intrinsic disorder or partial folding

    • Crystallization difficulties

    • Conformational heterogeneity

    • Partner-dependent folding

    • Unusual thermodynamic properties

  • Methodological adaptations:

    • Co-expression with potential partners

    • Stability enhancement through fusion partners or stabilizing mutations

    • Use of complementary structural techniques (CD, SAXS, NMR)

    • Development of custom activity assays

    • Integration of computational and experimental approaches

When studying MPN_670, researchers should consider that similar proteins from minimal genomes have shown diverse structural characteristics, with some exhibiting cooperative unfolding while others show no detectable unfolding upon thermal denaturation . These unusual properties necessitate adaptations to standard research protocols.

How should researchers approach the integration of MPN_670 data into the broader context of Mycoplasma pneumoniae systems biology?

Integrating MPN_670 research into systems biology frameworks requires methodical data collection and contextual analysis. The following approach is recommended:

  • Multi-omics data integration:

    • Transcriptomic analysis to identify co-expressed genes

    • Proteomic studies to confirm expression and identify post-translational modifications

    • Metabolomic profiling to detect metabolic changes upon MPN_670 perturbation

    • Interactomic mapping to position MPN_670 in protein networks

  • Network analysis methodology:

    • Construction of protein-protein interaction networks

    • Pathway enrichment analysis

    • Topological analysis to identify network position

    • Boolean network modeling to predict system-wide effects

  • Genome-scale modeling integration:

    • Incorporation of MPN_670 into genome-scale metabolic models

    • Constraint-based modeling to predict phenotypic effects

    • Flux balance analysis to identify potential metabolic roles

    • Model refinement based on experimental validation

  • Comparative systems analysis:

    • Cross-species comparison of network positions

    • Evolutionary analysis of system components

    • Minimal network identification

    • Essential gene context analysis

This systems biology approach is particularly valuable for uncharacterized proteins in minimal genomes, as their functions may only become apparent when viewed in the context of the entire biological system. The limited genome of Mycoplasma pneumoniae makes it an ideal model for such comprehensive analysis, potentially revealing emergent properties not detectable through isolated protein studies .

What are the most promising approaches for definitively determining MPN_670's function?

To definitively determine MPN_670's function, a multi-faceted research strategy combining cutting-edge techniques is recommended:

  • CRISPR-based functional genomics:

    • CRISPRi for conditional knockdown phenotyping

    • CRISPRa for overexpression studies

    • CRISPR scanning to identify essential domains

    • Base editing for point mutation analysis

  • Advanced structural studies:

    • Integrative structural biology combining X-ray, NMR, and cryo-EM

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Cross-linking mass spectrometry for interaction interfaces

    • Time-resolved structural analysis during functional cycles

  • High-resolution interactomics:

    • Proximity labeling in native conditions

    • Affinity purification-mass spectrometry with quantitative analysis

    • Protein complementation assays for direct interactions

    • Single-molecule interaction studies

  • Functional reconstitution:

    • In vitro reconstitution of potential biochemical activities

    • Cell-free expression systems for functional testing

    • Minimal synthetic biology approaches

    • Heterologous complementation in model organisms

These approaches should be implemented with awareness that MPN_670 may belong to a class of proteins with unusual biophysical properties, potentially requiring specialized experimental conditions . The comprehensive strategy allows for convergent validation of function through multiple independent lines of evidence.

How can researchers design experiments to test whether MPN_670 is essential for Mycoplasma pneumoniae viability?

Determining the essentiality of MPN_670 requires careful experimental design that accommodates the challenging nature of mycoplasma genetics. The following methodological framework is recommended:

  • Genetic manipulation approaches:

    • Transposon mutagenesis followed by deep sequencing (Tn-seq)

    • CRISPR interference with titratable repression

    • Antisense RNA knockdown with quantitative phenotyping

    • Attempted gene deletion with complementation controls

  • Conditional essentiality testing:

    • Essentiality assessment across different growth conditions

    • Nutrient limitation studies

    • Temperature sensitivity analysis

    • Host cell interaction contexts

  • Depletion phenotype characterization:

    • Growth curve analysis with quantitative metrics

    • Morphological assessment using advanced microscopy

    • Metabolic profiling during protein depletion

    • Transcriptional response to depletion

  • Comparative essentiality analysis:

    • Cross-species comparison in different mycoplasma

    • Correlation with minimal genome studies

    • Synthetic lethality screening with other genes

    • Essentiality prediction from network centrality measures

This rigorous approach to essentiality testing provides multiple lines of evidence while accommodating the unique challenges of working with mycoplasma species. The analysis should consider that proteins conserved across minimal genomes often play essential roles, even when their specific functions remain uncharacterized .

What biophysical techniques beyond circular dichroism should be prioritized for characterizing MPN_670's structure and dynamics?

While circular dichroism provides valuable initial structural insights, a comprehensive biophysical characterization of MPN_670 requires additional advanced techniques:

  • Solution-based structural techniques:

    • Small-angle X-ray scattering (SAXS) for molecular envelope determination

    • Nuclear magnetic resonance (NMR) for atomic-resolution dynamics

    • Analytical ultracentrifugation for oligomeric state analysis

    • Dynamic light scattering for homogeneity assessment

  • Stability and unfolding analysis:

    • Differential scanning calorimetry for thermodynamic parameters

    • Chemical denaturation monitored by fluorescence

    • Hydrogen-deuterium exchange mass spectrometry for local stability

    • Limited proteolysis coupled with mass spectrometry

  • Binding and interaction characterization:

    • Isothermal titration calorimetry for binding thermodynamics

    • Surface plasmon resonance for binding kinetics

    • Microscale thermophoresis for weak interactions

    • Bio-layer interferometry for real-time binding analysis

  • Single-molecule techniques:

    • Förster resonance energy transfer for conformational dynamics

    • Atomic force microscopy for mechanical properties

    • Single-molecule pull-down for rare interaction detection

    • Nanopore analysis for translocation properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.