Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_086 (MPN_086)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mycoplasma pneumoniae Uncharacterized Protein MPN_086 (MPN_086) is a hypothetical protein encoded by the mpn086 gene in M. pneumoniae. While its precise biological function remains uncharacterized, it is commercially available as a recombinant protein for research purposes. This article synthesizes available data on its structural features, production parameters, and potential applications, highlighting gaps in current research.

Protein Characterization

MPN_086 is a full-length recombinant protein derived from M. pneumoniae strain ATCC 29342/M129. Key details include:

ParameterValue/Description
Gene Namempn086
ORF NamesMP069, R02_orf105
Protein Length1–105 amino acids (aa)
TagDetermined during production (likely His-tag based on similar recombinant proteins)
Purity≥90% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol, pH unspecified
ApplicationsELISA, biochemical assays

Source: Commercial product specifications .

Production and Quality Control

MPN_086 is produced via recombinant expression in E. coli. Key production parameters include:

  • Expression Region: Full-length (1–105 aa).

  • Purification: Likely affinity chromatography (common for recombinant proteins with His-tags).

  • Stability: Repeated freeze-thaw cycles are discouraged; aliquots stored at -20°C/-80°C .

Quality Assurance: Purity is validated by SDS-PAGE, though specific contaminants or contaminants are not detailed.

Potential Applications

While MPN_086’s role in M. pneumoniae pathogenesis or metabolism is unknown, recombinant versions are marketed for:

  1. Serological Studies: Detecting host antibodies via ELISA .

  2. Protein-Protein Interaction Studies: Investigating binding partners in M. pneumoniae or host cells.

  3. Vaccine Development: Hypothetical inclusion in multivalent vaccines targeting M. pneumoniae surface proteins .

Research Gaps and Challenges

  1. Functional Annotation: No studies link MPN_086 to adhesion, metabolism, or immune evasion mechanisms, unlike P30 or P1 proteins .

  2. Immune Response: Antibody prevalence in infected individuals remains unexplored.

  3. Evolutionary Role: No data on recombination events or strain-specific variations (unlike P1/P30) .

Comparative Analysis with Related Proteins

ProteinGeneFunctionKey Features
MPN_086mpn086Uncharacterized105 aa, recombinant available
MPN_096mpn096Uncharacterized264 aa, His-tagged
MPN_668mpn668Organic hydroperoxide reductaseCys-based active site, antioxidant activity
P30mpn301Adhesin, immune targetProline-rich repeats, critical for motility

Note: MPN_086 lacks the functional diversity observed in adhesins (P30, P1) or metabolic enzymes (MPN_668) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributor for the specific delivery timeline.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize its inclusion.
Synonyms
MPN_086; MP069; R02_orf105; Uncharacterized protein MPN_086
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_086
Target Protein Sequence
MESALNQEFQIDFCVKNKKLLKILANVLIASWLSFVVFLILGCIAIDLFRFDLYSQFFFN HLSTLSALAWTFFVLAILFGAATLAINGFFYKEIRKKSAFKEDSK
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN086

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the current functional annotation status of MPN_086?

MPN_086 is currently classified as an "uncharacterized protein," indicating that its biological function remains to be experimentally determined. The protein has been assigned UniProt ID P75607 . In bacterial genomics research, such uncharacterized proteins represent significant knowledge gaps that require systematic functional annotation approaches.

Similar to approaches used for other bacterial species like Bacillus paralicheniformis, functional annotation of hypothetical proteins like MPN_086 would require comprehensive in silico analysis using bioinformatics tools combined with experimental validation . Function prediction typically involves sequence homology searches, domain identification, protein-protein interaction mapping, and structural analysis to generate functional hypotheses that can be tested experimentally.

What expression systems are used for recombinant MPN_086 production?

The recombinant MPN_086 protein is primarily expressed in E. coli expression systems . This heterologous expression system provides several advantages:

  • High protein yield for experimental studies

  • Well-established protocols for induction and purification

  • Compatibility with His-tag fusion strategies

  • Cost-effective production compared to other expression systems

The typical workflow involves:

  • Cloning the MPN_086 gene into an appropriate expression vector

  • Transformation into E. coli expression strains

  • Induction of protein expression (typically using IPTG for T7-based vectors)

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (IMAC for His-tagged proteins)

  • Quality control by SDS-PAGE to verify purity

What are the recommended storage conditions for recombinant MPN_086?

For optimal stability and activity of recombinant MPN_086 protein, the following storage conditions are recommended:

Storage ParameterRecommendation
Long-term storage-20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
Physical formLyophilized powder (before reconstitution)
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)
Working aliquotsStore at 4°C for up to one week

It's important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity . Centrifuging the vial briefly before opening is recommended to ensure the contents settle at the bottom.

What bioinformatic approaches can be applied to predict the function of MPN_086?

For uncharacterized proteins like MPN_086, a structured in silico approach combining multiple bioinformatics tools is recommended:

  • Sequence Homology Analysis:

    • BLAST searches against protein databases to identify homologs

    • Multiple sequence alignment with related sequences

    • Identification of conserved residues that may indicate functional sites

  • Domain and Motif Identification:

    • Pfam, InterPro, SMART, and CDD-BLAST for domain prediction

    • SCANPROSITE for motif identification

    • CATH and SUPERFAMILY for fold recognition

  • Structural Analysis:

    • Secondary structure prediction using tools like PSIPRED

    • 3D structure modeling using homology modeling (SWISS-MODEL) or ab initio methods

    • Structural comparison with proteins of known function

  • Network-Based Approaches:

    • Protein-protein interaction prediction using STRING database

    • Functional inference through "guilt by association" principles

    • Integration of genomic context information (gene neighborhood, fusion events)

  • Subcellular Localization Prediction:

    • Signal peptide prediction

    • Transmembrane helix prediction

    • Cellular compartment prediction

Based on the amino acid sequence of MPN_086, preliminary analysis suggests potential transmembrane regions, which might indicate a membrane-associated function, possibly in cellular transport or signal transduction.

What experimental strategies are most effective for functional characterization of uncharacterized proteins like MPN_086?

A comprehensive experimental approach to characterize MPN_086 would include:

  • Expression and Purification Optimization:

    • Testing different tags (His, GST, MBP) for improved solubility

    • Optimizing expression conditions (temperature, induction time, media)

    • Developing robust purification protocols

  • Structural Studies:

    • X-ray crystallography or NMR spectroscopy for high-resolution structure

    • Circular dichroism for secondary structure analysis

    • Limited proteolysis to identify domain boundaries

  • Interaction Studies:

    • Pull-down assays using the His-tagged protein as bait

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with potential partners

    • Cross-linking mass spectrometry

  • Functional Assays:

    • Enzymatic activity tests based on bioinformatic predictions

    • Phenotypic studies using gene knockout/knockdown in Mycoplasma

    • Complementation studies in heterologous systems

    • Ligand binding assays

  • Localization Studies:

    • Immunofluorescence microscopy using antibodies against the recombinant protein

    • Membrane fractionation studies

    • GFP-fusion protein localization

These approaches should be implemented in a stepwise manner, with each experiment informing the design of subsequent studies, gradually narrowing down potential functions.

How can recombinant MPN_086 be used to generate specific antibodies for research applications?

Generating specific antibodies against MPN_086 is crucial for many research applications. The process involves:

  • Immunogen Preparation:

    • Use purified His-tagged recombinant MPN_086 protein

    • Ensure protein purity >90% by SDS-PAGE

    • Conjugate to carrier protein if needed (though this may be unnecessary for the 105aa full-length protein)

  • Immunization Strategy:

    • Select appropriate animal model (rabbits for polyclonal, mice for monoclonal)

    • Design immunization schedule (primary + 3-4 boosters)

    • Monitor antibody titers by ELISA

  • Antibody Purification:

    • Affinity purification using immobilized recombinant MPN_086

    • Test for cross-reactivity against other Mycoplasma proteins

    • Validate specificity by Western blot and immunoprecipitation

  • Validation Experiments:

    • Western blot analysis of Mycoplasma pneumoniae lysates

    • Immunofluorescence microscopy to determine localization

    • Immunoprecipitation to identify interaction partners

A critical consideration is epitope selection. If generating antibodies against specific regions rather than the full protein, hydrophilic, surface-exposed regions should be prioritized to ensure accessibility in native protein conformations.

What challenges exist in studying membrane-associated proteins like MPN_086 and how can they be overcome?

Based on sequence analysis, MPN_086 likely contains transmembrane regions, presenting several experimental challenges:

ChallengeSolution Strategies
Protein solubility- Use detergents (DDM, CHAPS, OG) during purification
- Express soluble domains separately
- Utilize membrane-mimetic systems (nanodiscs, liposomes)
Proper folding- Optimize expression conditions (lower temperature, slower induction)
- Use specialized E. coli strains
- Consider cell-free expression systems
Functional assays- Reconstitute in artificial membranes
- Develop solid-phase binding assays
- Use liposome-based activity assays
Structural studies- Employ crystallization with lipidic cubic phase
- Consider cryo-EM for larger complexes
- Use NMR with isotope labeling for dynamic regions
Post-translational modifications- Check for modification sites in native Mycoplasma
- Consider eukaryotic expression for certain modifications

Additionally, Mycoplasma proteins have unique characteristics due to the organism's minimal genome and parasitic lifestyle. Studying MPN_086 in its native context may require developing Mycoplasma-specific genetic tools, which remain challenging due to the organism's unique biology and limited transformation efficiency .

What is the potential significance of MPN_086 in Mycoplasma pneumoniae pathogenesis?

Although MPN_086's function remains uncharacterized, several lines of evidence suggest potential roles in Mycoplasma pneumoniae pathobiology:

  • Membrane Association: The protein's sequence suggests membrane localization, which is often associated with host-pathogen interactions, environmental sensing, or transport functions.

  • Pathogen Biology: Mycoplasma pneumoniae causes respiratory infections including atypical pneumonia ("walking pneumonia") . Surface proteins often play crucial roles in adhesion, immune evasion, and nutrient acquisition.

  • Minimal Genome Context: Mycoplasma has one of the smallest genomes among self-replicating organisms. In such minimal genomes, most proteins serve essential functions, suggesting MPN_086 likely has biological importance despite its uncharacterized status.

  • Therapeutic Target Potential: If MPN_086 proves essential for Mycoplasma survival or virulence, it could represent a novel therapeutic target. This is particularly relevant given that Mycoplasma lacks a cell wall and is intrinsically resistant to cell wall-targeting antibiotics like penicillin .

Research focusing on gene knockout or knockdown, followed by virulence and fitness assays, would help establish the protein's role in pathogenesis.

How can structural studies of MPN_086 contribute to understanding its function?

Structural studies provide valuable insights into protein function through several approaches:

  • Structure-Function Relationships:

    • Identifying active sites or binding pockets

    • Recognizing structural motifs shared with proteins of known function

    • Mapping evolutionarily conserved surface patches

  • Experimental Approaches:

    • X-ray crystallography: Requires crystallization of purified His-tagged MPN_086

    • NMR spectroscopy: Suitable for studying dynamics if protein size permits

    • Cryo-EM: Useful if MPN_086 forms larger complexes

  • Computational Structure Prediction:

    • AlphaFold2 or RoseTTAFold for ab initio prediction

    • Molecular dynamics simulations to study conformational flexibility

    • Ligand docking to predict potential binding partners

  • Structure-Guided Functional Hypothesis Generation:

    • Identifying potential catalytic residues

    • Designing targeted mutations to test functional hypotheses

    • Predicting protein-protein interaction interfaces

Structural information can then guide the design of biochemical assays to test specific functional hypotheses, such as point mutations of key residues followed by activity measurements or interaction studies.

What methods can be used to identify interaction partners of MPN_086 in Mycoplasma pneumoniae?

Identifying interaction partners is crucial for understanding protein function within cellular networks:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express His-tagged MPN_086 in Mycoplasma or use purified recombinant protein

    • Perform pull-down experiments using Ni-NTA or anti-His antibodies

    • Identify binding partners by mass spectrometry

    • Validate interactions using reciprocal pull-downs

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use MPN_086 as bait against a Mycoplasma pneumoniae prey library

    • Perform directed Y2H for testing specific interaction candidates

    • Verify interactions in bacterial systems

  • Proximity Labeling Approaches:

    • Generate BioID or APEX2 fusions with MPN_086

    • Express in Mycoplasma (if possible) or heterologous systems

    • Identify proximity partners by streptavidin pull-down and MS

  • In Silico Prediction:

    • Use STRING database to predict functional partners based on:

      • Co-expression patterns

      • Genomic proximity

      • Co-occurrence across species

  • Cross-linking Studies:

    • Apply chemical cross-linkers to Mycoplasma cells

    • Enrich for MPN_086 complexes using specific antibodies

    • Identify cross-linked partners by mass spectrometry

The integration of multiple approaches provides the most reliable interaction network, as each method has inherent biases and limitations.

How can recombinant MPN_086 be used for developing diagnostic tools for Mycoplasma pneumoniae infections?

Recombinant MPN_086 can be leveraged for diagnostic applications through several approaches:

  • Serological Assays:

    • Use purified recombinant MPN_086 as antigen in ELISA assays

    • Develop lateral flow assays for point-of-care testing

    • Multiplex with other Mycoplasma antigens for improved sensitivity

  • Antibody Development:

    • Generate anti-MPN_086 antibodies for direct detection of the protein in clinical samples

    • Develop sandwich ELISA systems using paired antibodies

    • Create immunofluorescence assays for research and diagnostic applications

  • Molecular Diagnostic Enhancement:

    • Use protein structure information to design better PCR primers targeting the MPN_086 gene

    • Develop aptamers against MPN_086 for alternative detection methods

    • Create recombinase polymerase amplification (RPA) assays for field diagnostics

  • Validation Requirements:

    • Determine specificity across different Mycoplasma species

    • Establish sensitivity thresholds in various clinical sample types

    • Compare performance against existing diagnostic methods for Mycoplasma pneumoniae

It's worth noting that diagnostic development would require establishing whether MPN_086 is sufficiently immunogenic and specific to Mycoplasma pneumoniae before committing significant resources to assay development.

What quality control measures should be implemented when working with recombinant MPN_086?

Ensuring consistent quality of recombinant MPN_086 preparations is essential for reliable experimental outcomes:

  • Purity Assessment:

    • SDS-PAGE analysis: Should show >90% purity with expected molecular weight

    • Mass spectrometry validation of protein identity

    • Endotoxin testing if used in cellular or in vivo assays

  • Functionality Tests:

    • Thermal shift assays to assess protein stability

    • Circular dichroism to confirm proper folding

    • Activity assays (once function is determined)

  • Storage Stability Monitoring:

    • Periodic re-testing of stored aliquots

    • Documentation of freeze-thaw cycles

    • Use of stabilizing excipients like trehalose (6%) as included in standard buffer

  • Batch Consistency:

    • Lot-to-lot comparison by SDS-PAGE and functional assays

    • Standardized production protocols

    • Reference standards for comparative analysis

  • Documentation Practices:

    • Detailed record-keeping of production parameters

    • Certificate of analysis for each batch

    • Stability data under different storage conditions

Implementing these quality control measures ensures reproducibility in experimental outcomes and facilitates reliable comparison of results across different studies.

What are the considerations for scaling up production of recombinant MPN_086 for research purposes?

For researchers requiring larger quantities of MPN_086 protein:

  • Expression System Optimization:

    • Evaluate high-density fermentation systems

    • Consider auto-induction media for reduced hands-on time

    • Optimize codon usage for E. coli expression

    • Test different E. coli strains (BL21, Rosetta, ArcticExpress) for yield improvement

  • Purification Scale-Up:

    • Transition from gravity columns to FPLC/HPLC systems

    • Implement tangential flow filtration for initial concentration

    • Optimize buffer compositions for maximum stability

    • Consider on-column refolding if inclusion body purification is necessary

  • Quality Considerations at Scale:

    • Implement robust sampling plans throughout production

    • Increased emphasis on endotoxin removal for larger preps

    • Monitor batch-to-batch consistency more stringently

  • Downstream Processing:

    • Optimize lyophilization parameters for bulk storage

    • Develop aliquoting strategies for consistent reconstitution

    • Standardize reconstitution protocols with appropriate glycerol concentrations (5-50%)

  • Stability Enhancements:

    • Screen stabilizing excipients beyond standard trehalose (6%)

    • Evaluate alternative buffer systems if scaling issues emerge

    • Consider spray-drying as an alternative to lyophilization

When scaling up, maintaining the same level of purity (>90%) becomes more challenging but remains essential for research applications.

How can one design site-directed mutagenesis experiments to probe the function of MPN_086?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships:

  • Target Selection Strategies:

    • Conserved residues identified through multiple sequence alignments

    • Predicted functional sites from structural modeling

    • Charged or hydrophobic patches on the protein surface

    • Potential post-translational modification sites

  • Mutation Design Principles:

    • Conservative substitutions to probe subtle effects (e.g., Asp to Glu)

    • Non-conservative changes to abolish function (e.g., Asp to Ala)

    • Cysteine substitutions for subsequent chemical modification

    • Tryptophan substitutions for fluorescence-based assays

  • Technical Approach:

    • PCR-based mutagenesis of the expression construct

    • Gibson Assembly for multiple simultaneous mutations

    • Commercial mutagenesis kits for efficiency

    • Sequence verification before expression

  • Functional Assessment:

    • Compare expression and solubility to wild-type protein

    • Evaluate structural integrity by circular dichroism

    • Develop binding or activity assays based on predicted function

    • In silico analysis of mutational effects using molecular dynamics

  • Systematic Mutation Strategies:

    • Alanine scanning of selected regions

    • Domain swapping with related proteins

    • Creation of chimeric proteins to test domain functions

    • Truncation series to identify minimal functional units

These approaches can progressively reveal the critical residues and regions responsible for MPN_086's function, even in the absence of initial functional knowledge.

What comparative genomics approaches can provide insights into MPN_086 function?

Comparative genomics offers powerful perspectives on protein function through evolutionary analysis:

  • Homology Identification Across Species:

    • Search for MPN_086 homologs in other Mycoplasma species

    • Extend search to more distant bacterial phyla

    • Analyze conservation patterns across phylogenetic distance

  • Gene Neighborhood Analysis:

    • Examine genes adjacent to MPN_086 in the Mycoplasma pneumoniae genome

    • Look for conserved gene clusters across species

    • Identify operonic structures that suggest functional relationships

  • Phylogenetic Profiling:

    • Create presence/absence patterns across diverse organisms

    • Correlate with specific phenotypes or environmental adaptations

    • Identify co-evolving protein families

  • Evolutionary Rate Analysis:

    • Calculate selection pressure (dN/dS ratios) across protein regions

    • Identify highly conserved regions under purifying selection

    • Detect potential regions undergoing positive selection

  • Domain Architecture Analysis:

    • Compare domain organization with characterized proteins

    • Identify fusion events that suggest functional associations

    • Look for domain gain/loss patterns across evolution

These approaches can place MPN_086 in evolutionary context, providing hypotheses about its function based on conservation patterns and genomic context, similar to methods used for annotating hypothetical proteins in other bacterial species .

What high-throughput approaches could accelerate functional characterization of MPN_086?

Modern high-throughput technologies can rapidly generate functional hypotheses:

  • Phenotypic Screens:

    • CRISPR interference or knockdown of MPN_086 followed by growth phenotyping

    • Chemical genetic screens to identify compounds affecting MPN_086 function

    • Synthetic genetic array analysis to find genetic interactions

  • Structural Genomics Approaches:

    • High-throughput crystallization screening

    • Fragment-based screening to identify ligand binding sites

    • Thermal shift assays with compound libraries

  • 'Omics Integration:

    • Correlate MPN_086 expression with transcriptomic responses

    • Analyze impacts of MPN_086 deletion on the proteome

    • Metabolomic profiling to detect biochemical pathway disruptions

  • Protein Interaction Mapping:

    • High-throughput yeast two-hybrid screening

    • Protein microarray analysis using labeled MPN_086

    • BioID or APEX proximity labeling coupled with mass spectrometry

  • In Silico Methods:

    • Deep learning approaches for function prediction

    • Molecular dynamics simulations of protein behavior

    • Virtual screening of potential binding partners

These approaches generate large datasets that, when integrated, can rapidly converge on testable hypotheses about MPN_086 function, significantly accelerating the traditional characterization process.

How might MPN_086 be exploited as a potential therapeutic target for Mycoplasma pneumoniae infections?

If MPN_086 proves to be essential for Mycoplasma pneumoniae viability or virulence, its therapeutic targeting potential could be explored:

  • Target Validation:

    • Confirm essentiality through gene knockout or knockdown studies

    • Evaluate impact on growth, survival, and virulence

    • Determine conservation across clinical isolates

  • Inhibitor Development:

    • Structure-based drug design once 3D structure is available

    • High-throughput screening of compound libraries

    • Fragment-based drug discovery approaches

  • Therapeutic Modalities:

    • Small molecule inhibitors targeting active sites

    • Peptide-based inhibitors for protein-protein interactions

    • Antibody-based approaches if accessible on cell surface

  • Combination Therapies:

    • Synergy testing with conventional antibiotics

    • Multi-target approaches to reduce resistance development

    • Host-directed therapies in combination with direct targeting

  • Delivery Considerations:

    • Formulation for respiratory delivery (for Mycoplasma pneumoniae infections)

    • Penetration through biofilms if relevant

    • Intracellular delivery strategies if needed

Mycoplasma pneumoniae's intrinsic resistance to cell wall-targeting antibiotics like penicillin makes new targets particularly valuable . If MPN_086 proves to have a membrane-associated function as its sequence suggests, it could represent an accessible and specific target for novel antimicrobials.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.