Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_095 (MPN_095)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Protein Characteristics

The MPN_095 gene (synonyms: MP059, R02_orf254) resides in a genome containing numerous repetitive elements that facilitate antigenic variation in surface proteins . While not listed among characterized virulence factors like P1 adhesin (MPN141) or CARDS toxin (MPN372) , its presence in multiple recombinant protein databases suggests research utility.

Research Applications

Current documented uses include:

  • SDS-PAGE analysis: Used as a molecular weight marker due to consistent 90% purity

  • Antigen production: Commercial ELISA kits utilize this recombinant protein for antibody detection

  • Structural studies: The full-length sequence enables crystallization trials and epitope mapping

Functional Hypotheses

While direct evidence is lacking, comparative analysis suggests potential roles:

FeatureInference from Related Proteins
Membrane localizationPredicted transmembrane domains in sequence
Host interactionSimilar uncharacterized proteins in M. pneumoniae interact with immune components
Metabolic functionPossible involvement in nutrient uptake systems observed in other Mycoplasma proteins

Knowledge Gaps and Research Directions

Key unanswered questions:

  1. Does MPN_095 participate in M. pneumoniae's gliding motility machinery?

  2. What host proteins interact with this antigen?

  3. Can sequence variations occur through RepMP-mediated recombination like in P1/P40 adhesins?

Recent advances in mycoplasma proteomics (e.g., MLVA typing schemes ) provide tools to address these questions through:

  • CRISPR-Cas9 knockout studies

  • Co-immunoprecipitation with known virulence factors

  • Host-cell adhesion inhibition assays

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please include this detail in your order notes. We will then endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_095; MP059; R02_orf254; Uncharacterized protein MPN_095
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_095
Target Protein Sequence
MNQQLNTTRKSTAARGRMGLVGGILLVIGTCIGAGIFFKSERVLQNMGGNTTLALLVWLM AGITVILMGLALVEITAKAAFDDLALLSWTQKFTNNTFYKACKRFLIWIYLPTTFFFMPL YLVQSLQDGLRGFGVANHFNTPHDWAIWMVIVLLINLWFFFTSGLSVKWTSVQNVVLLLL KVIPLIAVVILALWLGASAEQMERQPVVPVKDFTAISPFFGWFSAMGAIFFAFDGFYVSA AAKTQLKKQKNYRK
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN095

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of MPN_095 protein?

MPN_095 is a full-length protein (254 amino acids) from Mycoplasma pneumoniae with an amino acid sequence of MNQQLNTTRKSTAARGRMGLVGGILLVIGTCIGAGIFFKSERVLQNMGGNTTLALLVWLMAGITVILMGLALVEITAKAAFDDLALLSWTQKFTNNTFYKACKRFLIWIYLPTTFFFMPLYLVQSLQDGLRGFGVANHFNTPHDWAIWMVIVLLINLWFFFTSGLSVKWTSVQNVVLLLLKVIPLIAVVILALWLGASAEQMERQPVVPVKDFTAISPFFGWFSAMGAIFFAFDGFYVSAAAKTQLKKQKNYRK . Analysis of this sequence suggests a transmembrane protein with hydrophobic domains that likely spans the bacterial membrane multiple times, consistent with its predicted role in membrane transport or structural integrity.

How was MPN_095 identified in the Mycoplasma pneumoniae genome?

MPN_095 was identified during comprehensive genome analysis of Mycoplasma pneumoniae. The protein was part of a re-annotation effort that improved the original genome annotation. During this process, researchers employed computational sequence analysis techniques including PSI-BLAST searches with a conservative statistical expectancy value threshold (E-value of 10^-6) and extensive comparison to available completely sequenced genomes, particularly M. genitalium . The annotation was further supported by experimental techniques including 2D gel electrophoresis and mass spectrometry analysis, which allowed direct identification of expressed proteins matched to sequences predicted from the genome .

What expression systems are used for producing recombinant MPN_095?

Recombinant MPN_095 is primarily expressed using E. coli-based expression systems with an N-terminal His-tag for purification purposes . The methodology involves:

  • Cloning the full-length MPN_095 gene (encoding amino acids 1-254) into an appropriate expression vector

  • Transforming the construct into E. coli expression hosts

  • Inducing protein expression under optimized conditions

  • Purifying the His-tagged protein using affinity chromatography

  • Lyophilization of the purified protein for storage stability

This system provides sufficient yields of the recombinant protein with greater than 90% purity as determined by SDS-PAGE, making it suitable for various research applications .

What are the recommended handling and storage conditions for recombinant MPN_095?

The recombinant MPN_095 protein requires specific handling protocols to maintain activity and stability:

  • Storage: Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting: Divide into working aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Working storage: Store working aliquots at 4°C for up to one week

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose, pH 8.0

Repeated freezing and thawing significantly reduces protein stability and should be avoided to maintain consistent experimental results .

What functional domains have been predicted in MPN_095 and how do they inform potential biological roles?

Detailed sequence analysis of MPN_095 reveals several potential functional domains that suggest its biological role:

The protein contains multiple predicted transmembrane domains characteristic of membrane transport proteins or structural membrane components. Hydrophobicity analysis indicates regions that likely span the bacterial membrane, particularly amino acids 10-30, 85-105, and 190-210 . The protein belongs to the category of "conserved hypothetical" proteins, indicating that while its function remains undetermined, homologous proteins exist in other species including M. genitalium .

Computational predictions suggest MPN_095 may function in:

  • Membrane transport (possibly ion or small molecule transport)

  • Cell envelope integrity maintenance

  • Cellular signaling processes

How does the genomic context of MPN_095 inform understanding of its potential function?

The genomic context analysis of MPN_095 provides critical insights into its potential functional associations:

MPN_095 was identified in the genomic re-annotation efforts of Mycoplasma pneumoniae, where it was categorized as a conserved hypothetical protein . The gene locus is positioned within regions containing other membrane-associated proteins, suggesting potential functional relationships or co-regulation with these neighboring genes. During the re-annotation process, researchers identified several previously unrecognized proteins in intergenic regions, though MPN_095 maintained its original annotation .

Understanding the genetic organization surrounding MPN_095 is essential for predicting:

  • Potential operon structures

  • Co-regulated gene expression patterns

  • Functional protein complexes

  • Metabolic pathway associations

Comparative genomic analysis with the closely related M. genitalium reveals conserved synteny in this region, suggesting an evolutionarily conserved function that may be essential for mycoplasma biology .

What experimental approaches are most effective for characterizing the function of uncharacterized proteins like MPN_095?

For uncharacterized proteins like MPN_095, a multi-faceted experimental approach is recommended:

  • Structural Analysis:

    • X-ray crystallography or cryo-EM to determine three-dimensional structure

    • NMR spectroscopy for dynamic structural information

    • Circular dichroism for secondary structure characterization

  • Functional Genomics:

    • Gene knockout or knockdown studies using CRISPR-Cas systems adapted for mycoplasma

    • Transcriptomic analysis under various conditions to identify co-regulated genes

    • Phenotypic screens of mutants to identify functional defects

  • Protein Interaction Studies:

    • Pull-down assays using the His-tagged recombinant protein

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Chemical cross-linking followed by mass spectrometry

  • Localization Studies:

    • Immunofluorescence microscopy using antibodies against MPN_095

    • Fractionation of bacterial cells followed by Western blotting

    • GFP fusion proteins to track cellular localization

  • Bioinformatic Prediction Validation:

    • Targeted assays based on predicted functions from sequence analysis

    • Site-directed mutagenesis of predicted functional residues

    • Comparative analysis with characterized homologues in related species

The integration of these approaches provides comprehensive insights into protein function that no single method can deliver independently.

What are the challenges in expressing and purifying membrane proteins like MPN_095?

Expression and purification of membrane proteins like MPN_095 present several specific challenges that researchers must address:

  • Solubility Issues:

    • Hydrophobic transmembrane domains tend to cause protein aggregation

    • Solution: Use specialized detergents (e.g., n-dodecyl-β-D-maltoside, CHAPS) during extraction and purification

  • Protein Folding:

    • Ensuring proper folding in heterologous expression systems

    • Solution: Consider membrane-mimetic environments such as nanodiscs or liposomes for reconstitution

  • Expression System Selection:

    • E. coli may not provide the appropriate membrane environment

    • Solution: Alternative expression hosts like Pichia pastoris or cell-free systems may better maintain native conformation

  • Purification Strategy:

    • Maintaining protein stability during extraction from membranes

    • Solution: Optimize buffer conditions with stabilizing agents like glycerol and specific pH ranges

  • Functional Assessment:

    • Verifying that the purified protein retains native activity

    • Solution: Develop functional assays specific to predicted activities of MPN_095

The current production protocol using E. coli with N-terminal His-tagging has been shown to yield protein with greater than 90% purity , but functional validation of the recombinant protein remains a critical step for research applications.

How can researchers effectively design antibody-based detection methods for MPN_095?

Designing effective antibody-based detection methods for MPN_095 requires strategic planning:

  • Epitope Selection:

    • Analyze the protein sequence for immunogenic regions, preferably those predicted to be exposed

    • Avoid transmembrane domains as they are typically poor antigens

    • Consider using the N-terminal or C-terminal regions which are often more accessible

  • Antibody Production Strategy:

    • Polyclonal antibodies: Immunize animals with purified recombinant MPN_095 or synthetic peptides from selected regions

    • Monoclonal antibodies: Screen hybridoma clones against specific epitopes

    • Recombinant antibodies: Phage display selection against the purified protein

  • Validation Methods:

    • Western blotting against both recombinant protein and native Mycoplasma pneumoniae lysates

    • Immunoprecipitation followed by mass spectrometry confirmation

    • Immunofluorescence to confirm cellular localization

    • ELISA to determine sensitivity and specificity

  • Controls and Standards:

    • Include the purified recombinant His-tagged MPN_095 as a positive control

    • Use pre-immune serum as a negative control

    • Perform peptide competition assays to confirm specificity

  • Cross-Reactivity Assessment:

    • Test against closely related mycoplasma species

    • Evaluate potential cross-reactivity with host proteins when designing diagnostic applications

The high purity (>90%) recombinant MPN_095 protein available from commercial sources provides an excellent immunogen starting point for antibody development .

What approaches should be used to investigate potential protein-protein interactions involving MPN_095?

Investigating protein-protein interactions for MPN_095 requires complementary techniques:

  • Co-Immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged MPN_095 from cell lysates

    • Identify interacting partners by mass spectrometry

    • Verify interactions by reciprocal Co-IP with antibodies against identified partners

  • Proximity-Based Labeling:

    • Fuse MPN_095 with BioID or APEX2 enzymes

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Crosslinking Mass Spectrometry:

    • Treat intact Mycoplasma cells with membrane-permeable crosslinkers

    • Isolate MPN_095 complexes and analyze by mass spectrometry

    • Map interaction interfaces based on crosslinked peptides

  • Bacterial Two-Hybrid System:

    • Construct fusion proteins with MPN_095 and potential partners

    • Screen for interactions based on reporter gene activation

    • Validate positive hits with alternative methods

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MPN_095 on a sensor chip

    • Flow potential interaction partners over the surface

    • Measure binding kinetics and affinity constants

  • Membrane Protein Complex Isolation:

    • Use gentle detergent solubilization to preserve native complexes

    • Separate by blue native PAGE or size exclusion chromatography

    • Identify components by mass spectrometry or Western blotting

When analyzing results, consider the membrane localization of MPN_095 and focus on interactions that occur in the context of the bacterial membrane environment.

How can researchers evaluate the impact of MPN_095 on Mycoplasma pneumoniae pathogenesis?

Evaluating MPN_095's role in pathogenesis requires comprehensive approaches:

  • Gene Disruption Studies:

    • Create knockout or knockdown strains using appropriate genetic tools

    • Compare growth characteristics in various media conditions

    • Assess survival under stress conditions (oxidative stress, antibiotic exposure)

  • Infection Models:

    • Use cell culture models (respiratory epithelial cells) to assess:

      • Adherence efficiency

      • Cytotoxicity

      • Inflammatory response induction

    • Consider suitable animal models for in vivo pathogenesis studies

  • Transcriptomic/Proteomic Analysis:

    • Compare wild-type and MPN_095-deficient strains

    • Identify differentially expressed genes/proteins

    • Focus on virulence factors and stress response elements

  • Host Response Assessment:

    • Measure cytokine/chemokine production in infected cells

    • Evaluate changes in epithelial barrier integrity

    • Assess immune cell recruitment and activation

  • Complementation Studies:

    • Reintroduce wild-type MPN_095 to knockout strains

    • Test site-directed mutants of key residues

    • Confirm restoration of phenotypes to validate specificity

  • Comparative Genomics:

    • Analyze MPN_095 conservation across clinical isolates

    • Correlate sequence variations with virulence differences

    • Compare with homologs in related pathogenic species

These approaches should be interpreted considering that M. pneumoniae is recognized as an important respiratory pathogen that can cause infections ranging from mild to life-threatening conditions .

What are the optimal conditions for functional reconstitution of MPN_095 in membrane mimetic systems?

Reconstituting membrane proteins like MPN_095 in membrane mimetic systems requires optimization of multiple parameters:

  • Selection of Membrane Mimetic:

    • Liposomes: Use mycoplasma-like lipid compositions (high cholesterol content, primarily phosphatidylcholine)

    • Nanodiscs: MSP1D1 scaffold proteins with POPC/POPE mixtures

    • Bicelles: DMPC/CHAPSO at q-ratios of 0.5-1.0

    • Amphipols: A8-35 or PMAL-C8 for NMR studies

  • Protein Extraction Protocol:

    • Solubilize from E. coli membranes using mild detergents (DDM, LMNG)

    • Purify via His-tag affinity in detergent-containing buffers

    • Maintain minimum critical micelle concentration throughout

  • Reconstitution Method:

    • Detergent dialysis: Gradual removal over 24-48 hours

    • Direct incorporation: Rapid dilution below critical micelle concentration

    • Bio-Beads absorption: Controlled rate of detergent removal

  • Buffer Optimization:

    • pH range: Test 6.5-8.0

    • Salt concentration: 100-300 mM NaCl

    • Additives: 5-10% glycerol, 1 mM EDTA

    • Stabilizers: 6% trehalose as used in lyophilized preparations

  • Functional Validation:

    • Circular dichroism to confirm secondary structure

    • Tryptophan fluorescence for tertiary structure analysis

    • Activity assays based on predicted function

    • Electron microscopy to confirm proper incorporation

The reconstituted MPN_095 should be tested promptly, as working aliquots are stable at 4°C for up to one week , while properly reconstituted membrane mimetic systems may extend functionality.

What mass spectrometry approaches are most suitable for characterizing post-translational modifications of MPN_095?

Comprehensive characterization of MPN_095 post-translational modifications (PTMs) requires specialized mass spectrometry approaches:

  • Sample Preparation:

    • Enzymatic digestion: Use multiple proteases (trypsin, chymotrypsin, Glu-C) for comprehensive coverage

    • Enrichment strategies: IMAC for phosphopeptides, lectin affinity for glycopeptides

    • Fractionate digests using HILIC or strong cation exchange

  • MS Instrumentation and Methods:

    • High-resolution MS/MS: Orbitrap or Q-TOF instruments

    • Fragmentation techniques:

      • HCD/CID for general PTM mapping

      • ETD/ECD for labile modifications

      • UVPD for challenging modifications

    • Data acquisition: Parallel reaction monitoring (PRM) for targeted analysis

  • PTM-Specific Approaches:

    • Phosphorylation: Neutral loss scanning for phosphate groups

    • Glycosylation: Glycopeptide oxonium ion detection

    • Lipidation: Specialized extraction methods and lipidomics analysis

  • Data Analysis Pipelines:

    • Search against M. pneumoniae protein database

    • Open modification searches to detect unexpected PTMs

    • Localization scoring for site-specific assignment

    • Manual validation of PTM spectrum matches

  • Quantitative Assessment:

    • Label-free quantification of modified peptides

    • SILAC or TMT labeling for comparative studies

    • Determine stoichiometry of modifications at specific sites

The application of these approaches is particularly valuable given that MPN_095 has been experimentally identified in proteomic studies of M. pneumoniae, confirming it is expressed in vivo and potentially subject to regulatory PTMs .

How can researchers develop effective assays to measure potential transport activity of MPN_095?

Developing transport activity assays for MPN_095 requires systematic experimental design:

  • Substrate Identification Strategy:

    • Computational prediction of transported molecules based on sequence homology

    • Screening of radiolabeled substrate libraries with reconstituted protein

    • Metabolomic comparison of wild-type and MPN_095-deficient strains

  • Vesicle-Based Transport Assays:

    • Prepare proteoliposomes with purified MPN_095

    • Establish ion/pH gradients across vesicle membranes

    • Monitor substrate accumulation inside vesicles:

      • Fluorescent substrates with fluorescence quenching

      • Radiolabeled substrates with rapid filtration

      • FRET-based sensors for real-time measurements

  • Electrophysiological Approaches:

    • Planar lipid bilayer recordings

    • Patch-clamp of giant proteoliposomes

    • Solid-supported membrane electrophysiology

  • Whole-Cell Transport Studies:

    • Compare uptake kinetics in wild-type vs. MPN_095-deficient strains

    • Competition assays with structural analogs

    • Inducible expression systems for controlled studies

  • Essential Controls:

    • Empty liposomes (no protein)

    • Inactive mutants (site-directed mutagenesis of key residues)

    • Specific inhibitors (if identified)

    • Temperature dependence to distinguish active vs. passive transport

  • Data Analysis Requirements:

    • Determine transport kinetics (Km, Vmax)

    • Evaluate substrate specificity

    • Assess energy coupling mechanisms (ATP, ion gradients)

    • Characterize regulatory factors

These methodologies should account for the challenging nature of membrane protein studies and the limited background information available for uncharacterized proteins like MPN_095.

How does MPN_095 compare to homologous proteins in other Mycoplasma species?

Comparative analysis of MPN_095 with homologs in other Mycoplasma species reveals important evolutionary and functional insights:

  • Sequence Conservation Analysis:

    • MPN_095 has a clear homolog in Mycoplasma genitalium, as identified during genome re-annotation efforts

    • Sequence identity typically ranges from 60-85% among Mycoplasma species

    • Transmembrane domains show higher conservation than loop regions

    • Key functional motifs (if present) are more highly conserved

  • Structural Predictions Comparison:

    SpeciesProtein IDLengthTM DomainsSequence Identity to MPN_095
    M. pneumoniaeMPN_095254 aa7-8100%
    M. genitaliumMG_289*248 aa7-8~70%*
    M. gallisepticumMGA_0841*261 aa*7-8~50%*
    *These values are estimates based on typical homology patterns and would need verification with actual sequence data
  • Genomic Context Conservation:

    • Synteny analysis shows conserved gene neighborhood in closely related species

    • Co-evolved gene clusters suggest functional relationships

    • Regulatory elements may be conserved upstream of homologous genes

  • Functional Implications:

    • Essential vs. non-essential status may vary between species

    • Adaptation to host-specific environments may be reflected in sequence variations

    • Species-specific amino acid substitutions may indicate adaptive evolution

  • Expression Pattern Differences:

    • Transcriptomic data comparison across species

    • Differential regulation under stress conditions

    • Growth phase-dependent expression patterns

This comparative approach is particularly valuable since MPN_095 is categorized as a "conserved hypothetical" protein, indicating homologs exist in other species while the function remains undetermined .

What insights can be gained from integrating genomic, transcriptomic, and proteomic data about MPN_095?

Multi-omics data integration provides comprehensive insights into MPN_095 biology:

  • Genomic Context Analysis:

    • The MPN_095 gene was maintained in the re-annotation of the M. pneumoniae genome, confirming its identification

    • Promoter analysis and regulatory element identification

    • Codon usage analysis to assess expression efficiency

    • Assessment of genetic variation across clinical isolates

  • Transcriptomic Correlation:

    • Expression conditions that upregulate or downregulate MPN_095

    • Co-expression networks with functionally related genes

    • Transcript stability and post-transcriptional regulation

    • Response to environmental stressors (temperature, pH, antibiotics)

  • Proteomic Validation:

    • Confirmation of protein expression by mass spectrometry

    • Relative abundance across different growth conditions

    • Post-translational modifications

    • Protein half-life and turnover rate

  • Integrated Data Visualization:

    Data TypeKey FindingFunctional Implication
    GenomicConserved across Mycoplasma speciesPotentially essential function
    TranscriptomicExpression pattern in correlation with membrane proteins*Possible role in membrane processes
    ProteomicDetected in membrane fractions*Confirms membrane localization
    *Hypothetical patterns based on typical membrane protein characteristics
  • Predictive Modeling:

    • Machine learning approaches to predict function from integrated data

    • Network analysis to position MPN_095 in cellular pathways

    • Identification of potential interacting partners across datasets

This multi-omics approach is particularly valuable for uncharacterized proteins like MPN_095, where individual datasets may provide limited insights but integration reveals functional patterns not apparent from single-omics analyses.

How can MPN_095 be utilized in developing diagnostic tools for Mycoplasma pneumoniae infection?

MPN_095 offers several potential applications in diagnostic development:

  • Antibody-Based Detection Systems:

    • ELISA assays using anti-MPN_095 antibodies to detect the protein in clinical samples

    • Lateral flow immunoassays for point-of-care testing

    • Immunofluorescence assays for direct visualization in tissue samples

  • Nucleic Acid Detection Platforms:

    • PCR primer design targeting the MPN_095 gene region

    • LAMP (Loop-mediated isothermal amplification) assays for field detection

    • Multiplex PCR panels including MPN_095 and other M. pneumoniae targets

  • Advantages as a Diagnostic Target:

    • Conservation across clinical isolates (if verified)

    • Potential membrane localization making it accessible for detection

    • Expression during infection as confirmed by proteomic studies

  • Validation Strategy:

    • Sensitivity testing against cultured M. pneumoniae strains

    • Specificity verification against related Mycoplasma species and common respiratory pathogens

    • Clinical sample validation with defined patient cohorts

  • Integration with Existing Diagnostic Approaches:

    • Complement molecular tests targeting established genes like P1 adhesin or CARDS toxin

    • Potential for multiplexed detection with macrolide resistance markers

    • Incorporation into syndromic testing panels for respiratory infections

The development of new diagnostic tools is particularly relevant given the clinical importance of M. pneumoniae as a respiratory pathogen and the challenges in its laboratory diagnosis .

What role might MPN_095 play in antimicrobial resistance mechanisms in Mycoplasma pneumoniae?

Investigating MPN_095's potential role in antimicrobial resistance requires systematic analysis:

  • Theoretical Resistance Mechanisms:

    • If MPN_095 functions as a transmembrane transporter, it could potentially:

      • Efflux antimicrobial compounds from the cell

      • Alter membrane permeability to reduce drug entry

      • Participate in stress response pathways activated by antibiotics

  • Experimental Approaches to Investigate Resistance Role:

    • Compare expression levels between susceptible and resistant strains

    • Analyze MPN_095 upregulation in response to antibiotic exposure

    • Assess phenotypic changes in MPN_095 knockout or overexpression strains

    • Measure antibiotic accumulation in cells with modified MPN_095 expression

  • Clinical Relevance:

    • Macrolide resistance has emerged worldwide in M. pneumoniae, complicating treatment

    • Novel resistance mechanisms beyond ribosomal mutations are of significant interest

    • Membrane proteins often contribute to intrinsic resistance in many bacterial species

  • Correlation Analysis:

    Antibiotic ClassPotential MPN_095 InvolvementInvestigation Method
    MacrolidesEfflux or permeabilityAccumulation assays
    FluoroquinolonesStress responseTranscriptional analysis
    TetracyclinesMembrane adaptationLipidomic analysis
  • Therapeutic Implications:

    • If involved in resistance, MPN_095 could be a target for inhibitor development

    • Inhibitors could potentially sensitize resistant strains to existing antibiotics

    • Expression levels might serve as biomarkers for resistance potential

Understanding the role of proteins like MPN_095 in antimicrobial resistance is particularly important given the worldwide emergence of drug resistance in M. pneumoniae and the limited treatment options available .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.