Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_096 (MPN_096)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

MPN_096 is encoded by the MPN_096 gene in Mycoplasma pneumoniae, a bacterium associated with respiratory infections. The recombinant variant is produced as a full-length protein (1–264 amino acids) with a His-tag for purification and stability . Key features include:

PropertyDetails
Gene IDMPN_096
Protein Length264 amino acids
Tag TypeHis-tag (N-terminal)
Host OrganismEscherichia coli
Purity>95% (via affinity chromatography)
Storage BufferTris-based buffer with 50% glycerol, pH 7–8
Storage Conditions-20°C (long-term), 4°C (short-term aliquots)

Amino Acid Sequence and Motifs

  • Primary Sequence: mLLGLGIVVLIYSLIALSVSLTTPNGAFSGLGDWLKHKKLGWFFGVLNLLIALGVAGIIN GFVMWTGKLTQSLIKSGELWVPDKCKLCLNKPKPVVGLIHAGILMVLTTVALSSLGGLLY LPKVNASYDGKGFKSMGCLLEFADLIATWTSVGIFWFLGLVLLGGLLQIKKPKRWYFRTT GWLAVVVIGLTTLVVMVQPFVDLGIAVFNRSYERIVANTILIAILVIIVLVMFFPTEPIK LRLWRKRIQAMEACGEDCDACVEY .

  • Predicted Domains: No annotated functional domains or homologs identified in public databases .

Stability and Handling

  • Thermal Stability: Susceptible to degradation upon repeated freeze-thaw cycles .

  • Solubility: Requires glycerol for stabilization; optimal activity in Tris-based buffers .

Expression and Production

MPN_096 is synthesized via recombinant DNA technology, with E. coli serving as the primary expression host. Key steps include:

Production Workflow

  1. Cloning: Insertion of the MPN_096 gene into a bacterial expression vector (e.g., pET-11c).

  2. Induction: Overexpression via IPTG induction in E. coli cells.

  3. Purification: Affinity chromatography (e.g., nickel- or cobalt-based resins) for His-tagged proteins .

  4. Quality Control: SDS-PAGE verification of purity (>95%) .

Functional Insights and Pathway Involvement

Despite its availability, MPN_096’s biological role remains undefined. Limited data suggest potential links to broader M. pneumoniae processes:

Hypothetical Functions

  • DNA Interactions: Homologs such as MPN229 (SSB protein) bind ssDNA and facilitate recombination . MPN_096 may share similar roles, though experimental evidence is lacking.

  • Antigen Variation: While MPN_096 is not directly linked to surface adhesins (e.g., P1, P40), recombination-driven antigen variation in M. pneumoniae often involves uncharacterized proteins .

Pathway Associations

PathwayRelated ProteinsPotential Role
DNA Replication/RepairMPN229 (SSB), MPN490 (RecA)SSB-like activity (speculative)
Protein SecretionHypothetical membrane-associated proteinsExport or localization (unconfirmed)

Note: No peer-reviewed studies directly implicate MPN_096 in these pathways.

Research Applications and Availability

MPN_096 is primarily used in:

  • Immunological Assays: ELISA and Western blotting to detect anti-M. pneumoniae antibodies .

  • Structural Studies: Crystallization or NMR to resolve 3D conformation.

  • Functional Screens: High-throughput assays to identify binding partners or enzymatic activities .

Key Limitations

  • Functional Ambiguity: No published studies describe MPN_096’s role in M. pneumoniae pathogenesis or metabolism.

  • Sequence Similarity: Low homology to characterized proteins in UniProt or NCBI databases .

Research Priorities

  1. Proteomic Interactions: Co-IP or pull-down assays to identify binding partners.

  2. Knockout Studies: M. pneumoniae mutants lacking MPN_096 to assess phenotypic changes.

  3. Biochemical Assays: Testing for enzymatic activity (e.g., ATPase, hydrolase).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MPN_096; MP058; R02_orf264; Uncharacterized protein MPN_096
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_096
Target Protein Sequence
MLLGLGIVVLIYSLIALSVSLTTPNGAFSGLGDWLKHKKLGWFFGVLNLLIALGVAGIIN GFVMWTGKLTQSLIKSGELWVPDKCKLCLNKPKPVVGLIHAGILMVLTTVALSSLGGLLY LPKVNASYDGKGFKSMGCLLEFADLIATWTSVGIFWFLGLVLLGGLLQIKKPKRWYFRTT GWLAVVVIGLTTLVVMVQPFVDLGIAVFNRSYERIVANTILIAILVIIVLVMFFPTEPIK LRLWRKRIQAMEACGEDCDACVEY
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN096

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why are uncharacterized proteins like MPN_096 significant in M. pneumoniae research?

Uncharacterized proteins represent critical research targets in M. pneumoniae studies for several reasons:

  • Despite M. pneumoniae having one of the smallest prokaryotic genomes (816 kb), a significant portion of its proteome remains functionally uncharacterized .

  • In the original genome annotation, 328 proteins (48%) lacked functional assignments, which subsequent re-annotation efforts have sought to address .

  • Expression data supports transcription of 184 functionally unassigned reading frames, confirming these proteins are produced during M. pneumoniae growth and likely contribute to its biology .

  • Uncharacterized proteins may play roles in pathogenesis, including immune evasion, adhesion, or other virulence mechanisms that contribute to the organism's ability to cause disease .

What is currently known about the gene expression of MPN_096?

While specific expression data for MPN_096 is limited in the provided search results, general insights regarding M. pneumoniae gene expression indicate:

  • Transcriptional evidence supports the expression of numerous uncharacterized proteins in M. pneumoniae, as confirmed through mRNA expression data .

  • The genomic context of MPN_096 (alternative identifier: MP058; R02_orf264) suggests it is actively transcribed under standard laboratory growth conditions .

  • The protein has been successfully expressed as a recombinant product, confirming the viability of the reading frame and expression capabilities .

  • Given M. pneumoniae's reduced genome and minimal transcriptional regulation machinery, MPN_096 is likely constitutively expressed rather than being under complex regulatory control.

What bioinformatic approaches can predict potential functions of MPN_096?

Multiple computational approaches can be employed to predict potential functions of MPN_096:

  • Sequence-Based Analysis:

    • Homology searches against characterized proteins in other Mycoplasma species and more distant organisms

    • Identification of conserved domains using tools like PFAM, PROSITE, or InterPro

    • Detection of signal peptides or transmembrane regions using tools like SignalP and TMHMM

  • Structural Prediction:

    • Ab initio or homology-based 3D structure prediction using tools like AlphaFold2 or I-TASSER

    • Secondary structure analysis to identify functional motifs

    • Molecular docking simulations to predict potential binding partners

  • Genomic Context Analysis:

    • Examination of neighboring genes for functional relationships

    • Investigation of gene clustering patterns across related species

    • Analysis of gene presence/absence patterns across Mycoplasma species with different host specificities

  • Evolutionary Analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Selection pressure analysis to identify functionally important residues

    • Comparison with related proteins in the minimal genome set of other Mycoplasma species

How might MPN_096 contribute to M. pneumoniae pathogenesis mechanisms?

Based on current understanding of M. pneumoniae pathogenesis, MPN_096 could potentially function in several pathogenic mechanisms:

  • Membrane-Associated Functions: The hydrophobic regions in MPN_096 suggest it may be membrane-associated, potentially contributing to:

    • Cell adhesion processes, similar to the P1 adhesin complex, which is crucial for M. pneumoniae pathogenicity

    • Membrane transport functions for nutrient acquisition in the host environment

    • Maintenance of membrane integrity under host-induced stress conditions

  • Immune Evasion: M. pneumoniae employs various strategies to evade host immunity, including:

    • Binding to host immunoglobulins, as seen with the IbpM protein (MPN400)

    • Degradation of NETs (neutrophil extracellular traps) through nuclease activity

    • Antigenic variation through homologous recombination of repetitive elements

    • MPN_096 could potentially participate in these or similar mechanisms

  • Oxidative Stress Response: M. pneumoniae induces and must survive oxidative stress:

    • The bacterium lacks conventional oxidative stress response enzymes (superoxide dismutase, catalase)

    • Proteins like MPN668 function as protective antioxidant enzymes

    • MPN_096 might play a role in oxidative stress protection or redox homeostasis

  • Host Cell Interaction: M. pneumoniae interacts with bronchial epithelial cells in ways that could involve MPN_096:

    • Modification of host cell signaling pathways, similar to MMP-9 regulation

    • Modulation of inflammatory responses

    • Intracellular survival mechanisms, as M. pneumoniae can invade cells and tissues

What experimental challenges exist in characterizing MPN_096 function?

Researchers face several significant challenges when attempting to characterize MPN_096:

  • Cultivation Difficulties:

    • M. pneumoniae has fastidious growth requirements, requiring specialized media

    • Slow growth rate (doubling time of 6-8 hours) extends experimental timelines

    • Difficulty in achieving high cell densities complicates protein purification

  • Genetic Manipulation Limitations:

    • Limited genetic tools available for M. pneumoniae

    • Challenges in creating targeted gene knockouts due to essential gene density

    • Difficulty in complementing mutations due to plasmid instability

    • UGA codon usage as tryptophan rather than stop codon complicates heterologous expression

  • Functional Assay Development:

    • Absence of obvious phenotypes for many gene disruptions

    • Limited knowledge of protein interaction networks

    • Challenges in developing relevant in vitro assays that reflect in vivo conditions

    • Difficulty distinguishing direct from indirect effects in a minimal genome organism

  • Protein-Specific Challenges:

    • Potential membrane association may require specialized purification techniques

    • Uncharacterized proteins often lack established functional assays

    • Limited availability of orthogonal validation approaches

    • Potential essentiality of the gene may complicate knockout studies

What are the optimal conditions for expressing and purifying recombinant MPN_096?

Based on available information about recombinant MPN_096 production and general protocols for Mycoplasma proteins:

  • Expression System:

    • E. coli is the preferred expression host, with BL21(DE3) or Rosetta strains accommodating Mycoplasma codon usage

    • Expression vector containing N-terminal His-tag for purification purposes

    • Induction conditions: typically 0.1-0.5 mM IPTG at 18-25°C for 16-20 hours to minimize inclusion body formation

  • Purification Protocol:

    • Lysis in Tris/PBS-based buffer with protease inhibitors

    • Clarification by high-speed centrifugation (20,000 × g, 30 minutes)

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Optional secondary purification by size exclusion chromatography

    • Final preparation in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Storage Considerations:

    • Store purified protein at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • For working stocks, store at 4°C for up to one week

    • Recommended reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Quality Control:

    • Verification by SDS-PAGE (>90% purity)

    • Confirmation of identity by Western blot and/or mass spectrometry

    • Assessment of proper folding by circular dichroism (CD) spectroscopy

    • Functional testing based on predicted activities

How can researchers design experiments to elucidate MPN_096 function?

A systematic experimental approach to characterize MPN_096 function could include:

  • Localization Studies:

    • Generate antibodies against purified MPN_096 or epitope-tagged versions

    • Perform immunofluorescence microscopy to determine subcellular localization

    • Use cell fractionation and Western blotting to confirm membrane association

    • Compare localization under different growth conditions or infection stages

  • Interaction Partner Identification:

    • Conduct pull-down assays using His-tagged MPN_096 to identify binding partners

    • Perform bacterial two-hybrid screening against M. pneumoniae library

    • Use crosslinking approaches followed by mass spectrometry

    • Validate interactions using co-immunoprecipitation or FRET techniques

  • Phenotypic Analysis:

    • Generate conditional knockdown strains (if direct knockout is not viable)

    • Assess impact on growth, morphology, and cytadherence

    • Evaluate effects on virulence in infection models

    • Measure changes in stress resistance (oxidative, pH, temperature)

  • Functional Assays Based on Predictions:

    • If membrane-associated, test for transport activity with various substrates

    • If potentially involved in adhesion, conduct cell attachment assays

    • If implicated in immune evasion, measure interaction with host immune components

    • If structurally similar to enzymes, test for corresponding enzymatic activities

What techniques can resolve contradictory findings about MPN_096 function?

When facing contradictory results regarding MPN_096 function, researchers can employ the following approaches:

  • Methodological Validation:

    • Compare protein expression levels and purity across studies

    • Assess the impact of different tags (His, GST, etc.) on protein function

    • Validate antibody specificity through multiple techniques

    • Repeat experiments using independently generated reagents

  • Orthogonal Techniques:

    • Apply multiple, independent methodologies to test the same hypothesis

    • Combine genetic, biochemical, and structural approaches

    • Use both in vitro and in vivo systems for validation

    • Implement CRISPR interference or antisense RNA for partial knockdown if complete knockout gives contradictory results

  • Condition-Dependent Function Assessment:

    • Test under varying physiological conditions (pH, temperature, nutrient availability)

    • Examine function during different growth phases

    • Assess activity in various infection models or cell types

    • Investigate potential functional redundancy with other proteins

  • Collaborative Validation:

    • Establish collaborations for independent verification of findings

    • Participate in method standardization across laboratories

    • Share reagents (antibodies, constructs) to minimize technical variables

    • Consider multilab validation studies for contentious functions

How could MPN_096 be utilized in diagnostic or therapeutic development?

MPN_096 presents several potential applications in diagnostic and therapeutic contexts:

  • Diagnostic Applications:

    • Development of serological assays to detect antibodies against MPN_096 in patient samples

    • Use as a biomarker for M. pneumoniae infection if expression correlates with disease stages

    • Component in multiplex PCR or antigen detection systems for improved sensitivity

    • Target for CRISPR-Cas-based diagnostic tests for rapid M. pneumoniae detection

  • Vaccine Development:

    • Assessment as a vaccine candidate if surface-exposed

    • Evaluation in combination with known immunogenic proteins (like P1)

    • Testing as a carrier protein for conjugate vaccines against M. pneumoniae

    • Exploration as a DNA vaccine component, similar to approaches with the P1 protein

  • Therapeutic Targets:

    • Screening for inhibitors if MPN_096 proves essential for growth or virulence

    • Development of antibody-based therapeutics if surface-accessible

    • Design of peptide inhibitors of protein-protein interactions involving MPN_096

    • Target for antisense oligonucleotide therapies to downregulate expression

  • Research Tools:

    • Use as a model system for studying membrane proteins in minimal genome organisms

    • Development as an expression tag for other difficult-to-express Mycoplasma proteins

    • Application in structural biology studies of minimal proteome components

    • Platform for studying host-pathogen interactions in simplified biological systems

What is the role of MPN_096 in the context of genome minimization in Mycoplasma species?

The presence of MPN_096 in the highly reduced genome of M. pneumoniae offers interesting insights into genome minimization:

  • Retention Despite Genome Reduction:

    • M. pneumoniae has undergone extensive genome reduction (816 kb), retaining only essential genes

    • The preservation of MPN_096 suggests it likely serves an important function, despite being uncharacterized

    • Comparative genomics across Mycoplasma species can reveal whether MPN_096 is part of the core minimal genome

  • Functional Density in Minimal Genomes:

    • In minimal genomes, proteins often perform multiple functions (moonlighting)

    • MPN_096 may have evolved to fulfill multiple roles to compensate for genome reduction

    • Understanding MPN_096 function could reveal adaptations enabling survival with limited genetic resources

  • Evolutionary Considerations:

    • Analysis of selective pressure on the MPN_096 sequence can indicate functional constraints

    • Comparison with orthologs in related species can reveal residues critical for function

    • Study of MPN_096 can contribute to understanding the minimal genetic requirements for cellular life

  • Synthetic Biology Applications:

    • Knowledge of MPN_096 function contributes to the goal of defining minimal gene sets

    • May inform design of synthetic minimal cells for biotechnology applications

    • Could help identify novel biological principles underlying genome minimization

How does research on MPN_096 relate to understanding M. pneumoniae pathogenesis mechanisms?

Research on MPN_096 connects to broader studies of M. pneumoniae pathogenesis in several ways:

  • Pathogenesis Mechanisms:

    • M. pneumoniae causes disease through multiple mechanisms including adhesion to respiratory epithelium, cytotoxicity, and immune modulation

    • Understanding MPN_096 may reveal new aspects of these pathogenic processes

    • Could help explain extrapulmonary manifestations of M. pneumoniae infections

  • Host-Pathogen Interactions:

    • M. pneumoniae interacts with host receptors, modifies signaling pathways, and evades immune responses

    • MPN_096 might participate in these interactions, particularly if membrane-associated

    • May relate to the observed downregulation of RECK and promotion of MMP-9 secretion by infected cells

  • Immune Evasion Strategies:

    • M. pneumoniae employs various immune evasion mechanisms including antigenic variation, production of immunoglobulin-binding proteins, and NET degradation

    • MPN_096 could contribute to survival within the host through similar or novel mechanisms

    • May help explain the persistent nature of some M. pneumoniae infections

  • Therapeutic Targets:

    • Understanding MPN_096 function could reveal new drug targets

    • May help explain antibiotic resistance or persistence

    • Could contribute to the development of targeted antimicrobials with reduced side effects

Comparison of MPN_096 with Other Uncharacterized M. pneumoniae Proteins

ProteinLength (aa)MW (kDa)pIPredicted FeaturesConservation in Other Mycoplasma Species
MPN_09626429.16.8Multiple hydrophobic regions, potential transmembrane domainsModerate
MPN_133VariedVariedVariedCalcium-dependent nuclease activity, associated with cell death and tissue damageHigh
MPN_400 (IbpM)VariedVariedVariedImmunoglobulin-binding, virulence factorHigh
MPN_491VariedVariedVariedMagnesium-dependent nuclease, degrades NETsHigh
MPN_668VariedVariedVariedProtective antioxidant enzyme, degrades hydroperoxideModerate

Note: This table compares MPN_096 with several M. pneumoniae proteins mentioned in the search results . Complete data for all fields is limited in the available information.

Experimental Approaches for Functional Characterization of MPN_096

ApproachTechniquesExpected OutcomesLimitations
Expression AnalysisqRT-PCR, RNA-seq, ProteomicsExpression patterns under different conditionsLimited inference of function
Localization StudiesImmunofluorescence, Cell fractionation, Membrane protein extractionCellular location, potential functionTechnical challenges with antibody specificity
Protein-Protein InteractionsPull-down assays, Bacterial two-hybrid, Co-immunoprecipitationInteraction partners, protein complexesPotential for false positives/negatives
Functional DisruptionCRISPR interference, Antisense RNA, Conditional knockoutsPhenotypic effects of reduced expressionChallenges if gene is essential
Structural AnalysisX-ray crystallography, Cryo-EM, NMR, In silico modeling3D structure, functional domains, binding sitesDifficulties in membrane protein crystallization
Biochemical AssaysEnzymatic activity tests, Binding assays, Transport studiesDirect functional evidenceRequires prediction of potential activities

Recombinant MPN_096 Expression and Purification Protocol

StepProcedureKey ParametersQuality Control
1. Vector ConstructionClone MPN_096 into expression vector with N-terminal His-tagCodon optimization for E. coliSequence verification
2. TransformationTransform into E. coli BL21(DE3) or Rosetta strainSelection on appropriate antibioticsColony PCR confirmation
3. ExpressionInduce with 0.1-0.5 mM IPTG at 18-25°C for 16-20 hoursMonitor OD600, optimize temperature and timeSDS-PAGE to verify expression
4. Cell HarvestingCentrifugation at 4,000 × g for 20 minutes at 4°CComplete removal of mediaCell pellet weight
5. LysisSonication or pressure homogenization in Tris/PBS buffer with protease inhibitorsBuffer pH 8.0, maintain 4°CMicroscopy to verify lysis
6. ClarificationCentrifugation at 20,000 × g for 30 minutes at 4°CComplete removal of cell debrisSDS-PAGE of supernatant and pellet
7. IMAC PurificationLoad supernatant on Ni-NTA resin, wash, eluteImidazole gradient elutionSDS-PAGE of fractions
8. Buffer ExchangeDialysis or gel filtration to Tris/PBS buffer with 6% trehalose, pH 8.04°C, multiple buffer changesConductivity measurement
9. ConcentrationUltrafiltration using appropriate MWCOAvoid protein precipitationProtein concentration assay
10. StorageAliquot and flash freezeAdd 5-50% glycerol for long-term storagePurity >90% by SDS-PAGE

This protocol is based on standard recombinant protein purification procedures and specific information from the MPN_096 protein product description .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.