MPN_096 is encoded by the MPN_096 gene in Mycoplasma pneumoniae, a bacterium associated with respiratory infections. The recombinant variant is produced as a full-length protein (1–264 amino acids) with a His-tag for purification and stability . Key features include:
| Property | Details |
|---|---|
| Gene ID | MPN_096 |
| Protein Length | 264 amino acids |
| Tag Type | His-tag (N-terminal) |
| Host Organism | Escherichia coli |
| Purity | >95% (via affinity chromatography) |
| Storage Buffer | Tris-based buffer with 50% glycerol, pH 7–8 |
| Storage Conditions | -20°C (long-term), 4°C (short-term aliquots) |
Primary Sequence: mLLGLGIVVLIYSLIALSVSLTTPNGAFSGLGDWLKHKKLGWFFGVLNLLIALGVAGIIN GFVMWTGKLTQSLIKSGELWVPDKCKLCLNKPKPVVGLIHAGILMVLTTVALSSLGGLLY LPKVNASYDGKGFKSMGCLLEFADLIATWTSVGIFWFLGLVLLGGLLQIKKPKRWYFRTT GWLAVVVIGLTTLVVMVQPFVDLGIAVFNRSYERIVANTILIAILVIIVLVMFFPTEPIK LRLWRKRIQAMEACGEDCDACVEY .
Predicted Domains: No annotated functional domains or homologs identified in public databases .
Thermal Stability: Susceptible to degradation upon repeated freeze-thaw cycles .
Solubility: Requires glycerol for stabilization; optimal activity in Tris-based buffers .
MPN_096 is synthesized via recombinant DNA technology, with E. coli serving as the primary expression host. Key steps include:
Cloning: Insertion of the MPN_096 gene into a bacterial expression vector (e.g., pET-11c).
Induction: Overexpression via IPTG induction in E. coli cells.
Purification: Affinity chromatography (e.g., nickel- or cobalt-based resins) for His-tagged proteins .
Despite its availability, MPN_096’s biological role remains undefined. Limited data suggest potential links to broader M. pneumoniae processes:
DNA Interactions: Homologs such as MPN229 (SSB protein) bind ssDNA and facilitate recombination . MPN_096 may share similar roles, though experimental evidence is lacking.
Antigen Variation: While MPN_096 is not directly linked to surface adhesins (e.g., P1, P40), recombination-driven antigen variation in M. pneumoniae often involves uncharacterized proteins .
| Pathway | Related Proteins | Potential Role |
|---|---|---|
| DNA Replication/Repair | MPN229 (SSB), MPN490 (RecA) | SSB-like activity (speculative) |
| Protein Secretion | Hypothetical membrane-associated proteins | Export or localization (unconfirmed) |
Note: No peer-reviewed studies directly implicate MPN_096 in these pathways.
MPN_096 is primarily used in:
Immunological Assays: ELISA and Western blotting to detect anti-M. pneumoniae antibodies .
Structural Studies: Crystallization or NMR to resolve 3D conformation.
Functional Screens: High-throughput assays to identify binding partners or enzymatic activities .
Functional Ambiguity: No published studies describe MPN_096’s role in M. pneumoniae pathogenesis or metabolism.
Sequence Similarity: Low homology to characterized proteins in UniProt or NCBI databases .
Proteomic Interactions: Co-IP or pull-down assays to identify binding partners.
Knockout Studies: M. pneumoniae mutants lacking MPN_096 to assess phenotypic changes.
Biochemical Assays: Testing for enzymatic activity (e.g., ATPase, hydrolase).
KEGG: mpn:MPN096
Uncharacterized proteins represent critical research targets in M. pneumoniae studies for several reasons:
Despite M. pneumoniae having one of the smallest prokaryotic genomes (816 kb), a significant portion of its proteome remains functionally uncharacterized .
In the original genome annotation, 328 proteins (48%) lacked functional assignments, which subsequent re-annotation efforts have sought to address .
Expression data supports transcription of 184 functionally unassigned reading frames, confirming these proteins are produced during M. pneumoniae growth and likely contribute to its biology .
Uncharacterized proteins may play roles in pathogenesis, including immune evasion, adhesion, or other virulence mechanisms that contribute to the organism's ability to cause disease .
While specific expression data for MPN_096 is limited in the provided search results, general insights regarding M. pneumoniae gene expression indicate:
Transcriptional evidence supports the expression of numerous uncharacterized proteins in M. pneumoniae, as confirmed through mRNA expression data .
The genomic context of MPN_096 (alternative identifier: MP058; R02_orf264) suggests it is actively transcribed under standard laboratory growth conditions .
The protein has been successfully expressed as a recombinant product, confirming the viability of the reading frame and expression capabilities .
Given M. pneumoniae's reduced genome and minimal transcriptional regulation machinery, MPN_096 is likely constitutively expressed rather than being under complex regulatory control.
Multiple computational approaches can be employed to predict potential functions of MPN_096:
Sequence-Based Analysis:
Homology searches against characterized proteins in other Mycoplasma species and more distant organisms
Identification of conserved domains using tools like PFAM, PROSITE, or InterPro
Detection of signal peptides or transmembrane regions using tools like SignalP and TMHMM
Structural Prediction:
Ab initio or homology-based 3D structure prediction using tools like AlphaFold2 or I-TASSER
Secondary structure analysis to identify functional motifs
Molecular docking simulations to predict potential binding partners
Genomic Context Analysis:
Examination of neighboring genes for functional relationships
Investigation of gene clustering patterns across related species
Analysis of gene presence/absence patterns across Mycoplasma species with different host specificities
Evolutionary Analysis:
Phylogenetic profiling to identify co-evolving proteins
Selection pressure analysis to identify functionally important residues
Comparison with related proteins in the minimal genome set of other Mycoplasma species
Based on current understanding of M. pneumoniae pathogenesis, MPN_096 could potentially function in several pathogenic mechanisms:
Membrane-Associated Functions: The hydrophobic regions in MPN_096 suggest it may be membrane-associated, potentially contributing to:
Immune Evasion: M. pneumoniae employs various strategies to evade host immunity, including:
Oxidative Stress Response: M. pneumoniae induces and must survive oxidative stress:
Host Cell Interaction: M. pneumoniae interacts with bronchial epithelial cells in ways that could involve MPN_096:
Researchers face several significant challenges when attempting to characterize MPN_096:
Cultivation Difficulties:
M. pneumoniae has fastidious growth requirements, requiring specialized media
Slow growth rate (doubling time of 6-8 hours) extends experimental timelines
Difficulty in achieving high cell densities complicates protein purification
Genetic Manipulation Limitations:
Limited genetic tools available for M. pneumoniae
Challenges in creating targeted gene knockouts due to essential gene density
Difficulty in complementing mutations due to plasmid instability
UGA codon usage as tryptophan rather than stop codon complicates heterologous expression
Functional Assay Development:
Absence of obvious phenotypes for many gene disruptions
Limited knowledge of protein interaction networks
Challenges in developing relevant in vitro assays that reflect in vivo conditions
Difficulty distinguishing direct from indirect effects in a minimal genome organism
Protein-Specific Challenges:
Potential membrane association may require specialized purification techniques
Uncharacterized proteins often lack established functional assays
Limited availability of orthogonal validation approaches
Potential essentiality of the gene may complicate knockout studies
Based on available information about recombinant MPN_096 production and general protocols for Mycoplasma proteins:
Expression System:
Purification Protocol:
Lysis in Tris/PBS-based buffer with protease inhibitors
Clarification by high-speed centrifugation (20,000 × g, 30 minutes)
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Optional secondary purification by size exclusion chromatography
Final preparation in Tris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Considerations:
Quality Control:
Verification by SDS-PAGE (>90% purity)
Confirmation of identity by Western blot and/or mass spectrometry
Assessment of proper folding by circular dichroism (CD) spectroscopy
Functional testing based on predicted activities
A systematic experimental approach to characterize MPN_096 function could include:
Localization Studies:
Generate antibodies against purified MPN_096 or epitope-tagged versions
Perform immunofluorescence microscopy to determine subcellular localization
Use cell fractionation and Western blotting to confirm membrane association
Compare localization under different growth conditions or infection stages
Interaction Partner Identification:
Conduct pull-down assays using His-tagged MPN_096 to identify binding partners
Perform bacterial two-hybrid screening against M. pneumoniae library
Use crosslinking approaches followed by mass spectrometry
Validate interactions using co-immunoprecipitation or FRET techniques
Phenotypic Analysis:
Generate conditional knockdown strains (if direct knockout is not viable)
Assess impact on growth, morphology, and cytadherence
Evaluate effects on virulence in infection models
Measure changes in stress resistance (oxidative, pH, temperature)
Functional Assays Based on Predictions:
If membrane-associated, test for transport activity with various substrates
If potentially involved in adhesion, conduct cell attachment assays
If implicated in immune evasion, measure interaction with host immune components
If structurally similar to enzymes, test for corresponding enzymatic activities
When facing contradictory results regarding MPN_096 function, researchers can employ the following approaches:
Methodological Validation:
Compare protein expression levels and purity across studies
Assess the impact of different tags (His, GST, etc.) on protein function
Validate antibody specificity through multiple techniques
Repeat experiments using independently generated reagents
Orthogonal Techniques:
Apply multiple, independent methodologies to test the same hypothesis
Combine genetic, biochemical, and structural approaches
Use both in vitro and in vivo systems for validation
Implement CRISPR interference or antisense RNA for partial knockdown if complete knockout gives contradictory results
Condition-Dependent Function Assessment:
Test under varying physiological conditions (pH, temperature, nutrient availability)
Examine function during different growth phases
Assess activity in various infection models or cell types
Investigate potential functional redundancy with other proteins
Collaborative Validation:
Establish collaborations for independent verification of findings
Participate in method standardization across laboratories
Share reagents (antibodies, constructs) to minimize technical variables
Consider multilab validation studies for contentious functions
MPN_096 presents several potential applications in diagnostic and therapeutic contexts:
Diagnostic Applications:
Development of serological assays to detect antibodies against MPN_096 in patient samples
Use as a biomarker for M. pneumoniae infection if expression correlates with disease stages
Component in multiplex PCR or antigen detection systems for improved sensitivity
Target for CRISPR-Cas-based diagnostic tests for rapid M. pneumoniae detection
Vaccine Development:
Therapeutic Targets:
Screening for inhibitors if MPN_096 proves essential for growth or virulence
Development of antibody-based therapeutics if surface-accessible
Design of peptide inhibitors of protein-protein interactions involving MPN_096
Target for antisense oligonucleotide therapies to downregulate expression
Research Tools:
Use as a model system for studying membrane proteins in minimal genome organisms
Development as an expression tag for other difficult-to-express Mycoplasma proteins
Application in structural biology studies of minimal proteome components
Platform for studying host-pathogen interactions in simplified biological systems
The presence of MPN_096 in the highly reduced genome of M. pneumoniae offers interesting insights into genome minimization:
Retention Despite Genome Reduction:
M. pneumoniae has undergone extensive genome reduction (816 kb), retaining only essential genes
The preservation of MPN_096 suggests it likely serves an important function, despite being uncharacterized
Comparative genomics across Mycoplasma species can reveal whether MPN_096 is part of the core minimal genome
Functional Density in Minimal Genomes:
In minimal genomes, proteins often perform multiple functions (moonlighting)
MPN_096 may have evolved to fulfill multiple roles to compensate for genome reduction
Understanding MPN_096 function could reveal adaptations enabling survival with limited genetic resources
Evolutionary Considerations:
Analysis of selective pressure on the MPN_096 sequence can indicate functional constraints
Comparison with orthologs in related species can reveal residues critical for function
Study of MPN_096 can contribute to understanding the minimal genetic requirements for cellular life
Synthetic Biology Applications:
Knowledge of MPN_096 function contributes to the goal of defining minimal gene sets
May inform design of synthetic minimal cells for biotechnology applications
Could help identify novel biological principles underlying genome minimization
Research on MPN_096 connects to broader studies of M. pneumoniae pathogenesis in several ways:
Pathogenesis Mechanisms:
Host-Pathogen Interactions:
Immune Evasion Strategies:
M. pneumoniae employs various immune evasion mechanisms including antigenic variation, production of immunoglobulin-binding proteins, and NET degradation
MPN_096 could contribute to survival within the host through similar or novel mechanisms
May help explain the persistent nature of some M. pneumoniae infections
Therapeutic Targets:
Understanding MPN_096 function could reveal new drug targets
May help explain antibiotic resistance or persistence
Could contribute to the development of targeted antimicrobials with reduced side effects
| Protein | Length (aa) | MW (kDa) | pI | Predicted Features | Conservation in Other Mycoplasma Species |
|---|---|---|---|---|---|
| MPN_096 | 264 | 29.1 | 6.8 | Multiple hydrophobic regions, potential transmembrane domains | Moderate |
| MPN_133 | Varied | Varied | Varied | Calcium-dependent nuclease activity, associated with cell death and tissue damage | High |
| MPN_400 (IbpM) | Varied | Varied | Varied | Immunoglobulin-binding, virulence factor | High |
| MPN_491 | Varied | Varied | Varied | Magnesium-dependent nuclease, degrades NETs | High |
| MPN_668 | Varied | Varied | Varied | Protective antioxidant enzyme, degrades hydroperoxide | Moderate |
Note: This table compares MPN_096 with several M. pneumoniae proteins mentioned in the search results . Complete data for all fields is limited in the available information.
| Approach | Techniques | Expected Outcomes | Limitations |
|---|---|---|---|
| Expression Analysis | qRT-PCR, RNA-seq, Proteomics | Expression patterns under different conditions | Limited inference of function |
| Localization Studies | Immunofluorescence, Cell fractionation, Membrane protein extraction | Cellular location, potential function | Technical challenges with antibody specificity |
| Protein-Protein Interactions | Pull-down assays, Bacterial two-hybrid, Co-immunoprecipitation | Interaction partners, protein complexes | Potential for false positives/negatives |
| Functional Disruption | CRISPR interference, Antisense RNA, Conditional knockouts | Phenotypic effects of reduced expression | Challenges if gene is essential |
| Structural Analysis | X-ray crystallography, Cryo-EM, NMR, In silico modeling | 3D structure, functional domains, binding sites | Difficulties in membrane protein crystallization |
| Biochemical Assays | Enzymatic activity tests, Binding assays, Transport studies | Direct functional evidence | Requires prediction of potential activities |
| Step | Procedure | Key Parameters | Quality Control |
|---|---|---|---|
| 1. Vector Construction | Clone MPN_096 into expression vector with N-terminal His-tag | Codon optimization for E. coli | Sequence verification |
| 2. Transformation | Transform into E. coli BL21(DE3) or Rosetta strain | Selection on appropriate antibiotics | Colony PCR confirmation |
| 3. Expression | Induce with 0.1-0.5 mM IPTG at 18-25°C for 16-20 hours | Monitor OD600, optimize temperature and time | SDS-PAGE to verify expression |
| 4. Cell Harvesting | Centrifugation at 4,000 × g for 20 minutes at 4°C | Complete removal of media | Cell pellet weight |
| 5. Lysis | Sonication or pressure homogenization in Tris/PBS buffer with protease inhibitors | Buffer pH 8.0, maintain 4°C | Microscopy to verify lysis |
| 6. Clarification | Centrifugation at 20,000 × g for 30 minutes at 4°C | Complete removal of cell debris | SDS-PAGE of supernatant and pellet |
| 7. IMAC Purification | Load supernatant on Ni-NTA resin, wash, elute | Imidazole gradient elution | SDS-PAGE of fractions |
| 8. Buffer Exchange | Dialysis or gel filtration to Tris/PBS buffer with 6% trehalose, pH 8.0 | 4°C, multiple buffer changes | Conductivity measurement |
| 9. Concentration | Ultrafiltration using appropriate MWCO | Avoid protein precipitation | Protein concentration assay |
| 10. Storage | Aliquot and flash freeze | Add 5-50% glycerol for long-term storage | Purity >90% by SDS-PAGE |
This protocol is based on standard recombinant protein purification procedures and specific information from the MPN_096 protein product description .