Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_112 (MPN_112)

Shipped with Ice Packs
In Stock

Description

Identification and Characteristics

MPN_112 is one of eleven previously unknown Mycoplasma pneumoniae proteins that were identified and characterized based on size and subcellular location . This was achieved through in vitro gene fusions using a modified mouse dehydrofolate reductase (dhfr) gene and selected regions of the M. pneumoniae genome, expressed in E. coli .

Key features of MPN_112:

  • Size and Location: Determined through immunoscreening Western blots of SDS-acrylamide gels from M. pneumoniae cell extracts using monospecific antibodies .

  • Sequence Information: The full-length protein sequence is available, with an expression region spanning 1-130 amino acids . The AA sequence is: mLDKLLQKFRDQKKPVFHKEEGYWEISALRKWAAILIIAFGAGIIYIVPYFAFFQFKTAVANVTGVEPNRISLLLTAYGIVSLLFYIPGGWLADRISAKALFSVSMFGTGIITFWYFLVG LKGIVWITPN .

  • Homology: Initial data-bank searches did not show significant homologies to known proteins .

Production and Availability

Recombinant MPN_112 is produced in E. coli and can be purchased for research purposes .

Information regarding its production:

  • Expression: Involves transfecting E. coli cells with a DNA expression vector that contains the gene encoding the recombinant protein .

  • Tag Information: The protein may include a tag, which will be determined during the production process .

  • Purity: Greater than 85% as measured by SDS-PAGE .

  • Storage: Recommended storage at -20℃, with working aliquots stored at 4℃ for up to one week . Repeated freezing and thawing are not recommended .

Research Applications

Recombinant MPN_112 is used in various research applications, including:

  • ELISA assays: It can be utilized as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) .

  • Antibody Production: Recombinant proteins are essential for generating specific antibodies, which can then be used to study the native protein within M. pneumoniae cells .

  • Protein Interaction Studies: To identify binding partners and understand its role in cellular processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_112; C09_orf130b; MP042; Uncharacterized protein MPN_112
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_112
Target Protein Sequence
MLDKLLQKFRDQKKPVFHKEEGYWEISALRKWAAILIIAFGAGIIYIVPYFAFFQFKTAV ANVTGVEPNRISLLLTAYGIVSLLFYIPGGWLADRISAKALFSVSMFGTGIITFWYFLVG LKGIVWITPN
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN112

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_112 and how is it classified within the Mycoplasma pneumoniae proteome?

MPN_112 is an uncharacterized protein from Mycoplasma pneumoniae, a cell wall-deficient respiratory pathogen with one of the smallest known genomes. The protein consists of 130 amino acids and is part of the minimalist proteome characteristic of this organism . Within the genomic annotation of M. pneumoniae, MPN_112 represents one of the gene products whose specific function remains to be fully elucidated, highlighting the challenges in characterizing proteins in reduced-genome organisms.

Methodologically, the classification of M. pneumoniae proteins typically involves proteogenomic mapping, which correlates mass spectral data to genomic structure. This approach has been particularly valuable for M. pneumoniae, as demonstrated by studies that have detected over 81% of genomically predicted ORFs in the M129 strain . When investigating an uncharacterized protein like MPN_112, researchers must examine sequence homology, predicted structural domains, and potential functional motifs to establish its preliminary classification.

What expression systems are most effective for producing recombinant MPN_112 protein?

Based on current research methodologies for Mycoplasma pneumoniae proteins, E. coli expression systems have proven most effective for MPN_112 production . The recombinant protein is commonly expressed with a histidine tag to facilitate purification. When designing expression protocols, researchers should consider:

Expression System ParameterRecommended ApproachRationale
Host strainE. coli BL21(DE3)Reduced protease activity; robust expression
Vector typepET-based expression vectorsTight regulation; high-level expression
Induction conditions0.5-1.0 mM IPTG, 16-20°C overnightLower temperature reduces inclusion body formation
Tag positionN-terminal His-tagFacilitates purification without affecting structure
Buffer compositionPBS with 10% glycerol, pH 7.4Enhances protein stability

The selection of expression parameters should be optimized based on protein solubility and yield. For proteins like MPN_112 from minimal organisms, codon optimization for E. coli expression may significantly improve yields .

How should researchers design experiments to characterize the function of previously uncharacterized proteins like MPN_112?

Characterizing uncharacterized proteins requires a systematic multidisciplinary approach. For MPN_112, the following experimental design framework is recommended:

  • Initial Bioinformatic Analysis:

    • Perform sequence homology searches against characterized proteins

    • Apply structure prediction algorithms (AlphaFold, Rosetta)

    • Identify conserved domains and potential functional motifs

  • Expression and Purification Strategy:

    • Express the protein with different tags (His, GST, MBP) to assess solubility

    • Optimize purification protocols using affinity chromatography followed by size exclusion

  • Functional Characterization:

    • Design protein-protein interaction studies (pull-down assays, Co-IP)

    • Conduct enzymatic activity assays based on predicted functions

    • Perform cellular localization studies using immunofluorescence

  • Biological Role Assessment:

    • Generate knockout mutants in M. pneumoniae

    • Compare phenotypes between wild-type and knockout strains

    • Conduct complementation studies to confirm phenotypic changes

  • Systems Biology Integration:

    • Perform transcriptomic and proteomic analyses to identify co-regulated genes

    • Map potential interactions in the context of known M. pneumoniae pathways

The experimental design should follow randomized block design principles when testing multiple conditions to control for batch effects . Statistical power analysis using packages like pwr4exp can help determine appropriate sample sizes for experiments .

What controls should be included when studying protein-protein interactions involving MPN_112?

When investigating protein-protein interactions of MPN_112, a comprehensive set of controls is essential to ensure experimental validity and meaningful interpretation of results:

Control TypeDescriptionPurpose
Negative controlsGST/His-tag alone without MPN_112Controls for non-specific binding to tags
Positive controlsKnown interacting protein pairs from M. pneumoniaeValidates experimental system functionality
Technical controlsReplicate pulls with different antibodies/beadsEnsures consistency across technical approaches
Biological controlsPulls from different growth conditionsIdentifies condition-dependent interactions
Competitive controlsAddition of excess untagged proteinConfirms specificity of observed interactions

For co-immunoprecipitation experiments, researchers should employ the methodology demonstrated in recent M. pneumoniae studies where DUF16 protein-NOD2 interactions were characterized using both GST pull-down technology followed by LC-MS/MS and confirmation through co-immunoprecipitation and immunofluorescence co-localization techniques .

The stringency of washing conditions should be systematically optimized to distinguish between specific and non-specific interactions. Additionally, reversed pull-down experiments (using the putative interacting partner as bait) should be conducted to validate initial findings .

What methodologies are most effective for predicting the structure of uncharacterized proteins like MPN_112?

Predicting the structure of uncharacterized proteins from minimal organisms like M. pneumoniae requires a multi-faceted approach combining:

  • Deep Learning-Based Structure Prediction:

    • AlphaFold2 and RoseTTAFold have revolutionized protein structure prediction and are particularly valuable for proteins like MPN_112 where experimental structures are unavailable

    • These approaches can predict structures with remarkable accuracy even in the absence of close homologs

  • Ab Initio Modeling:

    • For smaller proteins like MPN_112 (130 amino acids), ab initio methods can provide reliable structural models

    • Fragment-based approaches that utilize known structural patterns improve prediction accuracy

  • Molecular Dynamics Simulations:

    • MD simulations can refine predicted structures and evaluate their stability

    • Analysis of conformational ensembles may reveal functional dynamics

  • Experimental Validation:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Limited proteolysis to identify domain boundaries and flexible regions

    • Crosslinking mass spectrometry to validate predicted tertiary contacts

The integration of these computational and experimental approaches provides the most robust structural characterization. For proteins with potential homologs, researchers should also consider co-evolutionary analysis, which has proven effective in predicting structural contacts in bacterial proteins .

How can phosphoproteomics approaches be applied to understand potential post-translational modifications of MPN_112?

Phosphoproteomics provides critical insights into protein regulation and function. For characterizing potential phosphorylation of MPN_112, researchers should implement:

  • Sample Preparation Optimization:

    • Enrichment of phosphopeptides using titanium dioxide (TiO₂) or immobilized metal affinity chromatography (IMAC)

    • Careful selection of proteases beyond trypsin to maximize sequence coverage

  • MS/MS Analysis Strategy:

    • High-resolution mass spectrometry with electron transfer dissociation (ETD) or higher energy collisional dissociation (HCD)

    • Parallel reaction monitoring for targeted detection of predicted phosphosites

  • Data Analysis Pipeline:

    • Search against M. pneumoniae proteome with variable modifications

    • Manual validation of phosphosite assignments using fragment ion series

    • Phosphosite localization scoring using tools like PhosphoRS or PTM-score

  • Biological Context Integration:

    • Compare identified phosphosites with known kinase motifs

    • Assess conservation of phosphosites across related species

    • Correlate with kinase/phosphatase expression data

Previous phosphoproteomic studies of M. pneumoniae have identified 63 phosphorylated proteins with 16 specific phosphorylation sites (8 serine and 8 threonine residues) . These studies revealed that protein phosphorylation in M. pneumoniae appears to be highly organism-specific, with weak conservation of phosphorylation sites even when the same proteins are phosphorylated in related organisms . This approach would be valuable to determine if MPN_112 undergoes similar regulatory modifications.

What strategies can be employed to determine if MPN_112 plays a role in M. pneumoniae virulence mechanisms?

Investigating the potential role of MPN_112 in M. pneumoniae virulence requires a methodical approach combining genetic, biochemical, and infection models:

  • Gene Knockout and Complementation:

    • Generate MPN_112 deletion mutants using transposon mutagenesis or CRISPR-Cas systems adapted for mycoplasmas

    • Create complemented strains expressing wild-type or mutated MPN_112

    • Compare growth curves and cellular morphology between wild-type and mutant strains

  • Host-Pathogen Interaction Assays:

    • Cytadherence assays with human respiratory epithelial cells

    • Cytotoxicity measurements to assess hydrogen peroxide production (like GlpQ-dependent mechanisms)

    • Neutrophil extracellular trap (NET) degradation assays (similar to Mpn491)

  • Immune Response Characterization:

    • Measure cytokine production (TNF-α, IL-1β, IL-6, IL-17A) in cell culture models

    • Assess activation of innate immune receptors like NOD2, similar to studies with DUF16 protein

    • Evaluate antibody responses against MPN_112 in patient sera

  • In Vivo Models:

    • Mouse infection models to compare virulence of wild-type versus MPN_112 mutants

    • Histopathological examination of infected tissues

    • Immune cell profiling in infected tissues using flow cytometry

This experimental approach would be similar to those employed in the study of other M. pneumoniae virulence factors, such as the glycerophosphodiesterase GlpQ, which was found to be crucial for hydrogen peroxide release and cytotoxicity .

How might MPN_112 interact with host immune mechanisms based on our knowledge of other M. pneumoniae proteins?

While specific information about MPN_112's immune interactions is limited, we can propose potential mechanisms based on patterns observed with other M. pneumoniae proteins:

  • Potential Interaction with Pattern Recognition Receptors:

    • Similar to other M. pneumoniae proteins, MPN_112 might interact with Toll-like receptors (TLR2, TLR4) or NOD-like receptors

    • Recent research has identified DUF16 protein as interacting with NOD2 to induce inflammatory responses

    • Experimental approaches to test this would include reporter cell lines expressing specific PRRs

  • Possible Involvement in Immune Evasion:

    • M. pneumoniae employs several immune evasion mechanisms, including NETs degradation by Mpn491

    • Researchers should test if MPN_112 interacts with host immune factors like Factor H, similar to EF-Tu

    • Assays measuring complement deposition and phagocytosis with and without MPN_112 would be informative

  • Potential Role in Inflammatory Response Modulation:

    • Measurement of inflammatory cytokines (TNF-α, IL-1β, IL-6, IL-17A) in cell cultures exposed to purified MPN_112

    • Analysis of signaling pathway activation (NF-κB, MAPK) in immune cells

  • Possible Function in Oxidative Stress Response:

    • M. pneumoniae induces oxidative stress in host cells while protecting itself

    • Researchers should evaluate if MPN_112 has antioxidant properties similar to Mpn668

    • ROS production assays in the presence and absence of MPN_112 would help elucidate this role

These hypotheses should be systematically tested using both in vitro immune cell models and in vivo infection studies to establish MPN_112's immunomodulatory properties .

What approaches can be used to identify potential binding partners of MPN_112 in the minimal M. pneumoniae interactome?

The identification of MPN_112 binding partners requires specialized techniques given the minimal proteome of M. pneumoniae:

  • In Vitro Interaction Assays:

    • Affinity purification-mass spectrometry (AP-MS) using His-tagged MPN_112 as bait

    • Crosslinking MS to capture transient interactions

    • Proximity-dependent biotin identification (BioID) or APEX2 approaches adapted for M. pneumoniae

  • Yeast Two-Hybrid Screening:

    • Construction of M. pneumoniae genomic library for comprehensive screening

    • Membrane yeast two-hybrid systems may be needed if MPN_112 has membrane-associated properties

    • Validation of interactions through co-immunoprecipitation in M. pneumoniae lysates

  • In Silico Predictions:

    • Protein-protein interaction predictions based on structure and co-evolution

    • Analysis of genomic context and potential operonic structures

    • Integration with existing M. pneumoniae protein-protein interaction datasets

  • Functional Validation:

    • Co-purification assays from M. pneumoniae lysates

    • Surface plasmon resonance to determine binding kinetics

    • Functional assays to assess the biological relevance of identified interactions

A previous study examining interactions between glycolytic enzymes in M. pneumoniae demonstrated the value of these approaches in minimal organisms . Similar methodologies could be applied to MPN_112, potentially revealing its functional context within the M. pneumoniae interactome.

How can researchers design effective experimental controls when studying potentially unstructured or conditionally structured proteins like those found in minimal organisms?

Studying proteins with potentially unstructured regions requires specialized experimental design considerations:

Experimental ChallengeControl StrategyImplementation Method
Distinguishing functional from non-functional bindingScrambled sequence controlsGenerate recombinant proteins with same amino acid composition but randomized sequence
Confirming genuine structureCircular dichroism under varying conditionsTest protein structure in different buffers, pH, temperatures, and ligand presence
Validating condition-dependent foldingHydrogen-deuterium exchange MSCompare H/D exchange patterns under different conditions
Identifying relevant in vivo conformationsIn-cell NMRExpress isotope-labeled protein in E. coli and measure spectra in intact cells
Differentiating specific from non-specific interactionsCompetition assays with unlabeled proteinDemonstrate concentration-dependent displacement of labeled protein

These approaches are particularly relevant for M. pneumoniae proteins, which often have unconventional structures due to the organism's minimalist genome. For MPN_112, these controls would help distinguish its genuine biological roles from artifacts of experimental systems .

How might MPN_112 be included in multi-antigen vaccine development strategies against M. pneumoniae?

Incorporating MPN_112 into vaccine development would require systematic evaluation within the broader context of M. pneumoniae immunology:

  • Antigenicity and Immunogenicity Assessment:

    • ELISA-based screening of patient sera to determine natural antibody responses to MPN_112

    • Animal immunization studies comparing immune responses to MPN_112 alone vs. in combination with established antigens

    • Epitope mapping to identify immunodominant regions

  • Chimeric Antigen Design Strategies:

    • Construction of fusion proteins combining MPN_112 with established immunogens like P1C, P30, and P116N

    • This approach would be similar to the MP559 chimeric protein (P116N-P1C-P30) that showed promising results in rabbits

    • Structural modeling to ensure proper epitope presentation in chimeric constructs

  • Adjuvant Optimization:

    • Testing different adjuvant formulations to enhance specific immune responses

    • Evaluation of Th1/Th2/Th17 balance, as inappropriate Th17 responses have been associated with vaccine-enhanced disease

    • Mucosal adjuvant evaluation for respiratory tract immunity

  • Safety Evaluation:

    • Careful assessment for potential vaccine-enhanced disease as observed with certain M. pneumoniae lipoproteins

    • Monitoring for IL-17A-dependent inflammatory responses

    • Long-term immunological follow-up in animal models

Researchers should be cautious of potential harmful effects, as studies have shown that vaccination with M. pneumoniae lipid-associated membrane proteins (LAMPs) resulted in lipoprotein-dependent vaccine-enhanced disease after challenge with virulent M. pneumoniae . Proper controls and safety testing are therefore critical in any vaccine development involving novel M. pneumoniae antigens.

What comparative genomics approaches would be most informative for understanding the evolution and conservation of MPN_112 across Mycoplasma species?

Understanding the evolutionary context of MPN_112 requires sophisticated comparative genomics approaches:

  • Ortholog Identification Strategy:

    • Bidirectional best hit analysis across all sequenced Mycoplasma genomes

    • Profile hidden Markov models to identify distant homologs

    • Synteny analysis to identify positionally conserved genes despite sequence divergence

  • Evolutionary Rate Analysis:

    • Calculation of dN/dS ratios to assess selective pressure

    • Identification of positively selected sites using methods like PAML or HyPhy

    • Codon adaptation index analysis to assess translational selection

  • Structural Conservation Assessment:

    • 3D structure prediction of orthologs to identify conserved structural features despite sequence divergence

    • Identification of structurally conserved binding interfaces

    • Analysis of intrinsically disordered regions conservation

  • Functional Context Integration:

    • Genomic neighborhood analysis across species

    • Co-evolution with interacting partners

    • Correlation with host range and pathogenicity traits

  • Experimental Validation:

    • Complementation studies exchanging orthologs between different Mycoplasma species

    • Functional assays comparing activity of orthologs from diverse species

    • Host interaction studies with orthologs from species with different host tropisms

These approaches would build upon methodologies used in the development of the multilocus sequence typing (MLST) scheme for M. pneumoniae, which successfully differentiated isolates based on sequence polymorphisms in housekeeping genes .

What statistical approaches are most appropriate for analyzing protein function experiments with MPN_112?

Statistical analysis of protein function experiments requires careful consideration of experimental design and data characteristics:

  • Experimental Design Considerations:

    • Power analysis using pwr4exp in R to determine appropriate sample sizes

    • Implementation of randomized block designs to control for batch effects and environmental variables

    • Use of internal standards and technical replicates to quantify assay variation

  • Statistical Test Selection:

    • For comparing wild-type vs. mutant phenotypes: t-tests for simple comparisons, ANOVA for multiple conditions

    • For dose-response relationships: regression analysis with appropriate models (linear, sigmoidal)

    • For time-series data: repeated measures ANOVA or mixed-effects models

    • For binding assays: non-linear regression for Kd determination

  • Multiple Testing Correction:

    • Bonferroni correction for stringent control of family-wise error rate

    • Benjamini-Hochberg procedure for controlling false discovery rate in omics datasets

    • Sequential Bonferroni for balanced approach to multiple testing

  • Replication Criteria:

    • Following single-case design technical documentation principles requiring three demonstrations of experimental effect at different points

    • Implementation of both within-case and inter-case replication approaches

    • Active manipulation of independent variables with measurement of dependent variables occurring after manipulation

For complex datasets, researchers should consider consulting with statisticians specializing in biological systems to ensure appropriate analysis methodologies are applied to MPN_112 functional studies.

How should researchers integrate multi-omics data to contextualize the function of uncharacterized proteins like MPN_112?

Integrating multi-omics data for functional characterization of MPN_112 requires a systematic approach:

  • Data Collection and Preprocessing:

    • Genomic context analysis of MPN_112 locus and conservation

    • Transcriptomic data to identify co-expressed genes under various conditions

    • Proteomic data to detect protein expression levels and post-translational modifications

    • Interactomic data to identify protein-protein interaction networks

  • Multi-level Data Integration:

    • Network analysis combining transcriptomic and proteomic data

    • Pathway enrichment analysis to identify functional clusters

    • Machine learning approaches to predict function from integrated datasets

    • Bayesian networks to establish causal relationships

  • Visualization and Interpretation:

    • Creation of integrated functional networks with MPN_112 contextualized

    • Temporal modeling of expression and interaction patterns

    • Comparative analysis with characterized proteins in related functional categories

  • Validation Strategy:

    • Targeted experiments to test predictions from integrated analysis

    • CRISPR interference to perturb predicted functional connections

    • Protein domain swapping to test predicted functional domains

This integration approach has been successfully applied in studies of M. pneumoniae, such as the analysis of the GlpQ-dependent transcriptional regulation, which revealed higher or lower protein amounts of the glycerol facilitator, a subunit of a metal ion ABC transporter, and three lipoproteins in response to GlpQ activity .

What specialized resources and databases should researchers consult when studying uncharacterized Mycoplasma proteins like MPN_112?

Researchers investigating MPN_112 should utilize these specialized resources:

Resource TypeSpecific DatabasesApplication to MPN_112 Research
Mycoplasma-specific databasesMycoplasmaDB, MolligenGenomic context and conservation analysis
Protein structure databasesPDB, AlphaFold DB, SWISS-MODEL RepositoryStructural homologs and predicted structures
Protein domain databasesPfam, InterPro, SMARTIdentification of functional domains
Post-translational modification databasesPhosphoSitePlus, PHOSIDAPotential regulatory modifications
Microbial protein-protein interaction databasesSTRING, IntActPotential interaction partners
Bacterial secretion predictionSignalP, SecretomePSecretion potential assessment
Bacterial virulence databasesVFDB, VictorsComparison with known virulence factors
Immunological epitope databasesIEDBPrediction of antigenic regions

Additionally, researchers should consult the MLST database for M. pneumoniae (http://pubmlst.org/mpneumoniae) to understand genetic variation across clinical isolates that might affect MPN_112 function or expression .

How can researchers effectively address the challenges of working with proteins from minimal organisms in standard laboratory settings?

Working with proteins from minimal organisms presents unique challenges that require specialized approaches:

  • Contamination Prevention Strategy:

    • Implementation of PCR-based detection methods for common contaminants

    • Use of filtered pipette tips and dedicated equipment

    • Regular validation of cultures through selective media and microscopy

  • Growth and Cultivation Optimization:

    • Development of defined media components to replace serum requirements

    • Careful monitoring of pH and metabolic indicators during growth

    • Optimization of surface attachment for adherent mycoplasmas

  • Protein Expression Challenges:

    • Codon optimization for heterologous expression systems

    • Creation of fusion constructs with solubility-enhancing partners

    • Exploration of cell-free protein synthesis systems for difficult proteins

  • Functional Assay Adaptation:

    • Miniaturization of assays to accommodate limited material

    • Development of high-sensitivity detection methods

    • Use of surrogate systems to test function when direct assays are challenging

  • Collaborative Approach:

    • Establishment of collaborations with specialized mycoplasma research laboratories

    • Participation in research consortia focusing on minimal organisms

    • Sharing of specialized reagents and protocols through repositories

These approaches address the challenges noted in mycoplasma research, where complex media requirements and specialized growth conditions create barriers to standard protein characterization workflows .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.