Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_129 (MPN_129)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
MPN_129; C09_orf149b; MP025; Uncharacterized protein MPN_129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_129
Target Protein Sequence
MVSFFDIYTKASIVEAVRFSFLNTFQLKELGLPIKEIAVPLGTLVFLFVVIITLIPLLII GNLIWTNLRLIERENTQQYQLVFGYSLIVSDIVGFAIVFFGAILGTNLKSVELFIALGWM MMLGSLIALGTTANLVSSIYLYIKLALKR
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN129

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the genomic region containing MPN_129 organized in M. pneumoniae strains?

The genomic organization surrounding MPN_129 exhibits type-specific variations between M. pneumoniae strains:

  • In type 1 strains (including reference strain M129), the gene arrangement follows the order MPN129-MPN130-MPN131, where MPN130 contains a RepMP1 element.

  • In type 2 strains, MPN130 is completely deleted from this region, resulting in MPN129 being directly adjacent to MPN131 .

This genomic difference serves as one of the distinguishing features between type 1 and type 2 strains of M. pneumoniae. The deletion is clearly visualized in PCR amplification experiments that produce different-sized amplicons when primers targeting the MPN129-MPN131 region are used:

![PCR amplification of MPN129 to MPN131 regions shows type-specific differences in band sizes between type 1 and type 2 strains]

What expression systems are suitable for producing recombinant MPN_129 protein?

Based on current research protocols for M. pneumoniae proteins, E. coli is the preferred expression system for recombinant MPN_129 production. Full-length MPN_129 protein (amino acids 1-149) has been successfully expressed in E. coli with a His-tag for purification purposes .

The recommended expression protocol follows these general steps:

  • Clone the MPN_129 coding sequence into an expression vector containing a His-tag sequence

  • Transform into E. coli expression strain (typically BL21(DE3) or derivatives)

  • Induce protein expression using IPTG (0.5-1 mM) when cultures reach OD600 of 0.6-0.8

  • Express at lower temperatures (16-25°C) overnight to enhance proper folding

  • Harvest cells and proceed with protein purification

This approach is similar to methods used for other M. pneumoniae proteins such as MPN229 (SSB protein), which was purified to >95% homogeneity using affinity chromatography .

What are the recommended purification methods for recombinant MPN_129?

For His-tagged recombinant MPN_129, the following purification protocol is recommended:

  • Cell lysis:

    • Resuspend cell pellet in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors)

    • Lyse cells using sonication or alternative methods (French press, enzymatic lysis)

    • Clarify lysate by centrifugation (15,000-20,000 × g for 30 minutes)

  • Affinity chromatography:

    • Apply clarified lysate to Ni-NTA or cobalt-based affinity resin

    • Wash extensively with washing buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-40 mM imidazole)

    • Elute with elution buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250-300 mM imidazole)

  • Additional purification (if needed):

    • Size exclusion chromatography using appropriate column (e.g., Superdex 75/200)

    • Ion exchange chromatography if charge-based separation is required

  • Storage:

    • Store purified protein in Tris-based buffer with 50% glycerol at -20°C for extended storage

    • For longer-term storage, store at -80°C

    • Avoid repeated freeze-thaw cycles

Note: When working with membrane-associated proteins like MPN_129, addition of mild detergents (0.1% Triton X-100 or 0.05% DDM) to the purification buffers may improve protein solubility and stability.

What experimental approaches can be used to investigate the potential function of MPN_129?

Since MPN_129 is currently uncharacterized, multiple complementary approaches should be employed to determine its function:

  • Bioinformatic analysis:

    • Sequence homology searches

    • Structural prediction using tools like AlphaFold

    • Transmembrane domain prediction

    • Protein-protein interaction prediction

  • Proteomic approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS) to identify interacting partners

    • Crosslinking mass spectrometry to identify proximal proteins

    • Stable isotope dimethyl labeling for quantitative proteomic analysis, similar to techniques used for HCC biomarker discovery

  • Genetic approaches:

    • Gene knockout or knockdown using CRISPR or antisense RNA

    • Phenotypic characterization of mutants

    • Complementation studies

  • Localization studies:

    • Fluorescent protein tagging

    • Immunofluorescence microscopy

    • Cell fractionation followed by western blotting

  • Functional assays:

    • Membrane permeability assays

    • Transport studies if MPN_129 is suspected to be a transporter

    • DNA-binding assays if involved in genomic functions

These approaches should be designed with appropriate controls following experimental design principles outlined in standard research methodology .

How should experiments be designed to study the potential role of MPN_129 in genomic recombination events?

Given the genomic context of MPN_129 and its proximity to RepMP1 elements involved in recombination, experiments to investigate its role in genomic recombination should follow these approaches:

  • DNA-protein interaction assays:

    • Electrophoretic mobility shift assays (EMSA) with purified MPN_129 and DNA fragments containing RepMP1 sequences

    • Chromatin immunoprecipitation (ChIP) to identify genomic binding sites in vivo

    • DNA pull-down assays using biotinylated DNA fragments

  • Recombination assays:

    • In vitro recombination assays similar to those used for MPN490 (RecA homolog)

    • Measurement of recombination frequencies between RepMP1 elements in wild-type vs. MPN_129 mutant strains

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known recombination proteins (MPN229/SSB, MPN490/RecA)

    • Bacterial two-hybrid assays to test direct interactions

    • Pull-down assays with purified proteins

  • Experimental design considerations:

    • Use both type 1 and type 2 M. pneumoniae strains to assess strain-specific differences

    • Include proper controls (positive and negative)

    • Use replication to ensure statistical significance

    • Account for random and systematic errors in experimental setup

A factorial experimental design approach should be employed when testing multiple variables simultaneously to efficiently identify significant factors and interactions .

What biophysical methods are recommended for characterizing the structure and oligomeric state of MPN_129?

To thoroughly characterize the structural properties of MPN_129, the following biophysical methods are recommended:

  • Determination of oligomeric state:

    • Size exclusion chromatography (SEC)

    • Dynamic light scattering (DLS)

    • Native PAGE

    • Analytical ultracentrifugation (AUC)

    These approaches can determine whether MPN_129 exists as a monomer, dimer, or higher-order oligomer, similar to the analysis done for MPN229 (SSB) which was found to exist primarily as a homo-tetramer in solution .

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to estimate α-helical, β-sheet, and random coil content

    • FTIR spectroscopy as a complementary approach for secondary structure

  • Tertiary structure determination:

    • X-ray crystallography (if crystals can be obtained)

    • Nuclear magnetic resonance (NMR) spectroscopy (suitable for proteins <20 kDa)

    • Cryo-electron microscopy (cryo-EM) for larger complexes

  • Membrane protein-specific approaches:

    • If MPN_129 is confirmed as a membrane protein:

      • Detergent screening for optimal solubilization

      • Liposome reconstitution assays

      • Nanodiscs or amphipol stabilization for structural studies

  • Thermal stability assessment:

    • Differential scanning fluorimetry (DSF/Thermofluor)

    • Differential scanning calorimetry (DSC)

These methods should be applied systematically, starting with the least resource-intensive approaches to guide more advanced structural investigations.

How does MPN_129 relate to the RepMP1 elements and what might this reveal about M. pneumoniae genome evolution?

MPN_129 is located in a genomically dynamic region directly adjacent to the RepMP1-containing gene MPN130 in type 1 strains. This proximity to RepMP1 elements has significant implications for understanding M. pneumoniae genome evolution:

  • RepMP1 elements and genomic plasticity:

    • RepMP1 represents one of several repetitive elements in M. pneumoniae (others include RepMP2/3, RepMP4, and RepMP5)

    • Twenty full-length or partial copies of RepMP1 core elements have been identified throughout the M. pneumoniae chromosome

    • These elements facilitate homologous recombination events that contribute to genomic plasticity

  • Type-specific genomic differences involving MPN_129:

    • In type 1 strains (like M129), MPN129 is separated from MPN131 by MPN130

    • In type 2 strains, MPN130 is completely absent, resulting in MPN129 being adjacent to MPN131

    • This represents a consistent type-specific genomic difference

  • Proposed recombination model:

    • Short repeats (sReps) found in intergenic regions around MPN130 likely mediate homologous recombination

    • sRepB elements may be specifically involved in the deletion mechanism that removed MPN130 in type 2 strains

    • This recombination created the genomic arrangement observed in all type 2 strains

  • Evolutionary implications:

    • Despite the presence of numerous RepMP1 elements and associated short repeats throughout the genome, only specific recombination events are observed in natural isolates

    • This suggests selective constraints on genomic rearrangements

    • The consistent division into type 1 and type 2 strains indicates these genomic configurations may provide selective advantages in different contexts

What comparative genomic approaches can be used to study the evolution of MPN_129 across different Mycoplasma species and strains?

To investigate the evolution of MPN_129 across different Mycoplasma species and strains, researchers should consider these comparative genomic approaches:

  • Ortholog identification and analysis:

    • BLAST-based identification of MPN_129 orthologs in other Mycoplasma species

    • Synteny analysis to compare genomic context conservation

    • Identification of closest homologs, such as MG091 in Mycoplasma genitalium (61% identity to MPN229)

  • Phylogenetic analysis:

    • Multiple sequence alignment of MPN_129 orthologs

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Comparison of MPN_129 phylogeny with species phylogeny to detect horizontal gene transfer or unusual evolutionary patterns

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to detect positive, negative, or neutral selection

    • Identification of specific sites under selection

    • Comparison of selection pressures between different lineages

  • Analysis of genomic neighborhood:

    • Systematic comparison of genes flanking MPN_129 across different strains and species

    • Identification of conserved and variable elements in the genomic neighborhood

    • Reconstruction of ancestral genomic arrangements

  • Population genomics:

    • Analysis of MPN_129 sequence variation across multiple clinical isolates

    • Identification of single nucleotide polymorphisms (SNPs) and structural variants

    • Association of specific variants with strain types or phenotypic characteristics

This comprehensive approach will provide insights into the evolutionary history of MPN_129 and its role in Mycoplasma genome evolution.

What methods can be used to identify and validate protein-protein interactions involving MPN_129?

To systematically identify and validate protein-protein interactions (PPIs) involving MPN_129, researchers should employ a multi-method approach:

  • Identification of potential interaction partners:

    a. Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged MPN_129 in M. pneumoniae or heterologous system

    • Purify MPN_129 along with interacting proteins

    • Identify co-purified proteins by mass spectrometry

    • Compare against negative controls to filter non-specific interactions

    b. Proximity-based labeling approaches:

    • BioID or TurboID fusion proteins to biotinylate proximal proteins

    • APEX2-based proximity labeling

    • Crosslinking mass spectrometry (XL-MS)

    c. Yeast two-hybrid (Y2H) screening:

    • Screen MPN_129 against a library of M. pneumoniae proteins

    • Similar to the bacterial two-hybrid approach used for glycolytic enzymes in M. pneumoniae

  • Validation of identified interactions:

    a. Co-immunoprecipitation (Co-IP):

    • Generate antibodies against MPN_129 or use epitope tags

    • Perform reciprocal Co-IP experiments

    • Detect interactions by western blotting

    b. Bimolecular fluorescence complementation (BiFC):

    • Fuse MPN_129 and candidate partners to split fluorescent protein fragments

    • Reconstitution of fluorescence indicates interaction

    • Allows visualization of interaction subcellular localization

    c. Surface plasmon resonance (SPR) or microscale thermophoresis (MST):

    • Measure direct binding between purified proteins

    • Determine binding affinity constants

    • Evaluate binding kinetics

  • Functional analysis of interactions:

    a. Mutational analysis:

    • Generate point mutations or truncations in MPN_129

    • Identify regions required for specific interactions

    • Test functional consequences of disrupting interactions

    b. Competition assays:

    • Use peptides derived from interaction interfaces to disrupt specific interactions

    • Assess functional consequences of disruption

  • Data analysis and network construction:

    a. Integration of multiple datasets:

    • Assign confidence scores based on detection in multiple assays

    • Filter against common contaminants and non-specific binders

    b. Network visualization and analysis:

    • Construct interaction networks and identify functional clusters

    • Compare with known protein complexes and pathways

This systematic approach will provide a comprehensive view of MPN_129's interaction network and functional roles within M. pneumoniae.

How might researchers investigate the potential involvement of MPN_129 in M. pneumoniae pathogenicity?

Given that genomic variations involving MPN_129's genomic region differ between strain types, investigating its potential role in pathogenicity requires a comprehensive approach:

  • Comparative virulence studies:

    • Compare virulence of type 1 vs. type 2 strains in cellular and animal models

    • Create isogenic strains differing only in the MPN_129 genomic region

    • Measure differences in adherence, cytotoxicity, and inflammatory responses

  • MPN_129 knockout/knockdown experiments:

    • Generate MPN_129 deletion mutants or knockdown strains

    • Assess effects on:

      • Growth characteristics

      • Cell morphology

      • Adherence to host cells

      • Cytotoxicity (similar to that observed with prkC mutants)

      • Biofilm formation

      • Stress responses

  • Host-pathogen interaction studies:

    • Analyze MPN_129 expression during infection

    • Investigate localization during host cell interaction

    • Test for interaction with host proteins using pull-down assays

  • Immunological studies:

    • Test if MPN_129 elicits immune responses in infected hosts

    • Evaluate potential as a diagnostic marker

    • Assess presence of anti-MPN_129 antibodies in patient sera

  • Experimental design considerations:

    • Include multiple M. pneumoniae strains (both type 1 and type 2)

    • Use appropriate cellular models (human respiratory epithelial cells)

    • Include suitable controls (wild-type strains, complemented mutants)

    • Ensure experimental replication and statistical validation

    • Follow principles of randomization and local control in experimental design

These approaches will help determine whether MPN_129 contributes to M. pneumoniae pathogenicity and whether the different genomic arrangements in type 1 vs. type 2 strains affect virulence.

What computational methods can be applied to predict the function of MPN_129 based on its sequence and genomic context?

For uncharacterized proteins like MPN_129, computational prediction methods can provide valuable insights to guide experimental work:

  • Sequence-based function prediction:

    • Homology searches using PSI-BLAST, HHpred, or HMMER

    • Motif and domain identification using InterPro, PFAM, and PROSITE

    • Functional site prediction (active sites, binding sites)

    • Transmembrane topology prediction using TMHMM or Phobius

    • Signal peptide prediction

    • Disorder prediction

  • Structure-based function prediction:

    • Structure prediction using AlphaFold2 or RoseTTAFold

    • Structural similarity searches against PDB

    • Binding site and cavity analysis

    • Molecular docking with potential ligands

    • Molecular dynamics simulations to identify flexible regions

  • Genomic context-based predictions:

    • Gene neighborhood analysis

    • Phylogenetic profiling (co-occurrence patterns)

    • Gene fusion analysis

    • Analysis of co-expression patterns

    • Analysis of shared regulatory elements

  • Network-based approaches:

    • Guilt-by-association in protein interaction networks

    • Integration of multi-omics data (transcriptomics, proteomics)

    • Identification of functional modules

  • Machine learning approaches:

    • Feature extraction from sequence and structure

    • Training on proteins with known functions

    • Function prediction using supervised learning algorithms

By integrating predictions from multiple computational methods, researchers can develop testable hypotheses about MPN_129 function and prioritize experimental approaches for functional characterization.

Table of Experimental Approaches for MPN_129 Characterization

Experimental ApproachMethodologyExpected OutcomesAdvantagesLimitations
Recombinant protein expressionE. coli expression with His-tagPurified MPN_129 proteinFast, high yieldMay not retain native conformation
Structural analysisCD spectroscopy, X-ray crystallography, NMRSecondary/tertiary structureDirect structural informationMay require optimization for membrane proteins
DNA binding assaysEMSA, DNA pull-downInteraction with RepMP1 sequencesDirect measurement of bindingMay not reflect in vivo conditions
Localization studiesFluorescent tagging, immunofluorescenceSubcellular localizationPreserves cellular contextTag may interfere with function
Protein-protein interactionsAP-MS, Y2H, Co-IPIdentification of interaction partnersComprehensive interactomeFalse positives/negatives
Gene knockoutCRISPR, homologous recombinationPhenotypic effectsDirect functional evidenceMay be lethal if essential
Comparative genomicsOrtholog analysis, synteny studiesEvolutionary conservationInsight into importanceLimited by available genomes
Biochemical assaysActivity assays based on predictionsSpecific molecular functionDirect functional evidenceRequires functional hypothesis
Transcriptional analysisRNA-seq, qPCRExpression patternsRegulation insightsDoesn't confirm protein function
Pathogenicity studiesCell culture, animal modelsRole in virulenceDirectly addresses clinical relevanceComplex, multifactorial readouts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.