Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_373 (MPN_373)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPN_373; A19_orf204; MP463; Uncharacterized protein MPN_373
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_373
Target Protein Sequence
MVSDGGGQTDNNAEGGNLRIALTKNAFNPNQSTTVDIPYKIENRSVGNNKEQKTLVFDFS GLNPYEYNMIVGALFTDSSFINDAYAPIQSTFQRQLKEFLQVKYENQVGANGSFDLFKPR SLSSQQLVQGERSLDGFTVELNANGGSFNFLTHVDPLVAGLTVAAIASVVVAGAVTYLVV RRYRKRNEFVDKIFASNIRAKQWR
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN373

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic context of MPN_373 in Mycoplasma pneumoniae?

MPN_373 is located in a significant genomic region of M. pneumoniae with the following context:

  • MPN_373 (gene ID: mpn373) is positioned adjacent to the CARDS toxin gene (mpn372) in the M. pneumoniae genome

  • It is transcribed from the complementary strand, in contrast to the cards gene

  • The MPN_373 gene is separated from the upstream cards gene by a 10-nucleotide short intergenic region in a tail-to-tail orientation

  • MPN_373 encodes a hypothetical protein of unknown function

This genomic arrangement suggests potential functional relationships between MPN_373 and adjacent genes, particularly considering the opposite transcriptional orientation compared to the neighboring CARDS toxin gene.

What are the recommended expression and purification methods for recombinant MPN_373?

For optimal expression and purification of recombinant MPN_373:

  • Expression system: Use E. coli as the expression host with an N-terminal His-tag fusion

  • Purification: Apply affinity chromatography using the His-tag for initial purification

  • Final form: Prepare as a lyophilized powder for long-term stability

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

How can MPN_373 be studied in the context of genomic engineering experiments?

MPN_373 can be studied using recombinase-assisted genomic engineering (RAGE) technology, which allows for precise manipulation of the M. pneumoniae genome. The methodological approach includes:

  • Landing pad insertion: Create recipient strains containing landing pads for recombination-mediated cassette exchange (RMCE)

  • Region capture: For studying MPN_373 in its genomic context, capture the desired genomic region (such as the region from mpn372 to mpn400) using yeast recombination-based cloning

  • Genetic manipulation: Perform targeted modifications on the captured region using either:

    • Yeast-based recombination systems

    • BAC recombineering techniques in E. coli SW105 cells expressing the λ Red recombination system

  • Integration back into M. pneumoniae: Transform the modified construct into the recipient M. pneumoniae strain

This approach allows researchers to study the function of MPN_373 through genetic modifications such as gene deletion, replacement, or mutation in its native genomic context.

What is the significance of the intergenic regions surrounding MPN_373 in experimental design?

The intergenic regions surrounding MPN_373 present unique research opportunities:

  • Unusually large noncoding DNA: The intergenic regions between mpn373-mpn374, mpn374-mpn375, and mpn375-mpn376 have a total size of 1751 bp, which is unusually large for the compact M. pneumoniae genome

  • Experimental considerations:

    • When designing genomic engineering experiments, researchers must decide whether to retain or delete these intergenic regions

    • Studies have developed two versions of engineered constructs: one retaining and one deleting these intergenic regions

  • Research implications:

    • These regions may contain regulatory elements affecting gene expression

    • Comparative studies with and without these regions can provide insights into their functional significance

    • The unusually large size suggests potential evolutionary importance or horizontal gene transfer events

How can MPN_373 function be analyzed in relation to the adjacent CARDS toxin?

Given MPN_373's proximity to the CARDS toxin gene (mpn372), several experimental approaches can elucidate potential functional relationships:

  • Co-transcription analysis:

    • Reverse transcription PCR (RT-PCR) to identify individual transcripts

    • Primer extension (PE) analysis to determine transcriptional start points

  • Promoter analysis:

    • Examine sequences upstream of the transcriptional start point

    • Identify consensus features of M. pneumoniae promoters, such as the −10 element (Pribnow box) and AT-rich regions

  • Functional interaction studies:

    • Co-immunoprecipitation to detect protein-protein interactions

    • Two-hybrid systems to screen for potential binding partners

    • Comparative phenotypic analysis of single and double gene deletions

  • Expression correlation studies:

    • RNA-seq analysis under various conditions to identify co-regulation patterns

    • Proteomics approaches to quantify protein abundance correlations

What transposon mutagenesis approaches can be used to study MPN_373 essentiality?

Advanced transposon mutagenesis coupled with next-generation sequencing provides powerful tools to study MPN_373 essentiality:

  • LoxTnSeq methodology:

    • Apply transposon mutagenesis to create a library of M. pneumoniae mutants

    • Use ultra-sequencing to identify transposon insertion sites

    • Analyze the distribution of insertions to determine gene essentiality

  • Essentiality classification framework:

    • Essential (E): No viable mutants with disruptions in the gene

    • Non-essential (NE): Mutants with disruptions show no growth defects

    • Fitness (F): Mutants show reduced but viable growth

  • Epistatic effects analysis:

    • Study combinatorial gene deletions including MPN_373

    • Analyze fitness effects of single gene deletions versus larger deletions

    • Identify synthetic lethal interactions or fitness compensation effects

What are the recommended approaches for structural characterization of MPN_373?

For comprehensive structural characterization of the uncharacterized MPN_373 protein:

  • Protein structure prediction methods:

    • Apply AlphaFold or RoseTTAFold for initial structure prediction

    • Validate predictions through experimental approaches

  • Experimental structure determination:

    • X-ray crystallography: Optimize crystallization conditions for His-tagged recombinant MPN_373

    • NMR spectroscopy: For dynamics studies of protein regions

    • Cryo-EM: If MPN_373 forms part of larger complexes

  • Structural-functional correlation:

    • Structure-guided mutagenesis targeting predicted functional domains

    • In silico docking studies to predict potential binding partners

    • Molecular dynamics simulations to understand conformational changes

  • Post-translational modification analysis:

    • Mass spectrometry to identify potential modifications

    • Phosphoproteomic analysis to detect phosphorylation sites

    • Glycosylation studies if relevant in the native host

How can researchers design experiments to identify potential functions of MPN_373?

Design a comprehensive experimental strategy to elucidate MPN_373 functions:

  • Sequence-based function prediction:

    • Bioinformatic analysis for conserved domains and motifs

    • Phylogenetic analysis to identify orthologs with known functions

    • Machine learning approaches trained on protein function databases

  • Protein interaction studies:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with suspected interaction partners

    • Proximity labeling methods (BioID or APEX)

  • Gene expression analysis:

    • Transcriptomic profiling under various stress conditions

    • RT-qPCR validation of expression patterns

    • Reporter gene fusions to study promoter activity

  • Phenotypic characterization of knockout/knockdown mutants:

    • Growth curve analysis under various conditions

    • Microscopy to detect morphological changes

    • Virulence assays if pathogenicity is suspected

What considerations should be made when designing recombinant MPN_373 constructs for specific research applications?

When designing recombinant MPN_373 constructs:

  • Expression vector selection:

    • Consider codon optimization for the expression host

    • Select appropriate promoter strength based on experimental needs

    • Choose tag location (N-terminal vs. C-terminal) based on predicted protein structure

  • Fusion tag options:

    • His-tag for purification via immobilized metal affinity chromatography

    • GST-tag for improved solubility and pull-down experiments

    • Fluorescent protein fusions for localization studies

    • Split-tag systems for protein-protein interaction studies

  • Construct validation strategy:

    • Sequencing to confirm the correct sequence

    • Western blotting to verify expression and size

    • Mass spectrometry to confirm protein identity

    • Activity assays if function is known or predicted

  • Expression optimization parameters:

    • Temperature, IPTG concentration, and induction time

    • Media composition and additives

    • Co-expression with chaperones if solubility issues arise

How should researchers interpret contradictory findings regarding MPN_373 function?

When faced with contradictory data about MPN_373:

  • Systematic validation approach:

    • Replicate experiments under standardized conditions

    • Use multiple complementary techniques to test the same hypothesis

    • Consider strain differences that might explain contradictions

  • Critical evaluation of methodologies:

    • Assess differences in experimental conditions

    • Evaluate the sensitivity and specificity of different methods

    • Consider the limitations of each approach

  • Integration with genomic context data:

    • Analyze the genomic neighborhood for clues about function

    • Consider potential polar effects in genetic studies

    • Examine conservation across Mycoplasma species

  • Collaborative validation:

    • Engage with other laboratories for independent verification

    • Share reagents to ensure comparability of results

    • Consider publishing contradictory findings with appropriate caveats

What statistical approaches are recommended for transposon mutagenesis data analysis involving MPN_373?

For robust statistical analysis of transposon mutagenesis data:

  • Essentiality scoring methods:

    • Calculate insertion index (number of insertions/gene length)

    • Apply hidden Markov models to classify gene essentiality

    • Use statistical tests to determine significant deviations from random insertion patterns

  • Comparative analysis frameworks:

    • Compare insertion patterns across different growth conditions

    • Analyze gene essentiality in different genetic backgrounds

    • Conduct time-course studies to identify conditionally essential genes

  • Advanced bioinformatic approaches:

    • Machine learning algorithms to predict essentiality based on multiple features

    • Network analysis to identify functional modules

    • Integration with other -omics datasets (transcriptomics, proteomics)

  • Visualization and interpretation tools:

    • Genome browsers with integrated transposon insertion data

    • Heat maps of insertion density across the genome

    • Statistical significance plots for essentiality calls

What emerging technologies could advance our understanding of MPN_373?

Several cutting-edge technologies hold promise for MPN_373 research:

  • CRISPR-based approaches:

    • CRISPR interference (CRISPRi) for gene silencing

    • CRISPR activation (CRISPRa) for upregulation

    • Base editing for precise nucleotide modifications

    • Screens for genetic interactions

  • Single-cell technologies:

    • Single-cell RNA-seq to study heterogeneity in expression

    • Time-lapse microscopy combined with fluorescent reporters

    • Microfluidics for controlled environmental perturbations

  • Spatial transcriptomics/proteomics:

    • Localization of MPN_373 within the bacterial cell

    • Co-localization studies with interaction partners

    • Temporal dynamics of protein localization

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Constraint-based modeling of metabolic networks

    • Machine learning for prediction of protein function and interactions

How might research on MPN_373 contribute to understanding minimal genome concepts?

MPN_373 research has significant implications for minimal genome studies:

  • Essentiality classification:

    • Determining whether MPN_373 is essential, non-essential, or a fitness gene

    • Understanding its role in the context of the minimal bacterial genome

  • Functional redundancy analysis:

    • Identifying potential backup systems that may compensate for MPN_373 loss

    • Studying synthetic lethal interactions with other genes

  • Comparative genomics approach:

    • Analyzing conservation across Mycoplasma species with different genome sizes

    • Examining presence/absence in synthetic minimal genomes like JCVI-syn3.0

  • Evolutionary considerations:

    • Understanding why uncharacterized proteins are maintained in highly reduced genomes

    • Exploring the selective pressures that maintain apparently non-essential genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.