Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_575 (MPN_575)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, specifying your desired tag type will prioritize its use in development.
Synonyms
MPN_575; D02_orf128; MP267; Uncharacterized protein MPN_575
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_575
Target Protein Sequence
MLQNLALSFPFITRFFQKQMLGSQNSSGKTPGFNEAEGITSNIFQIAGGISLLVILLLII GFLSCLLGGIFLHKHKYAEVGSPAHAKTKNLFVAFFVVGSLLLLVAVVMLIAFGVLDASL PLPKENNS
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN575

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma pneumoniae Uncharacterized protein MPN_575?

MPN_575 is an uncharacterized protein encoded by the MPN_575 gene in Mycoplasma pneumoniae. This protein consists of 128 amino acids and is also known by synonyms including D02_orf128 and MP267 . It has a UniProt ID of P75204 and represents one of many proteins in M. pneumoniae that currently lack definitive functional characterization . As M. pneumoniae is the smallest prokaryotic microorganism capable of independent survival without a host cell, its proteins are of particular interest in understanding minimal cellular requirements for life .

How should researchers design experiments to characterize MPN_575 function?

When designing experiments to characterize MPN_575, researchers should apply rigorous experimental design principles:

  • Establish clear hypotheses about potential functions based on sequence analysis (hydrophobic regions suggest membrane association)

  • Design proper controls - Campbell and Stanley's experimental design frameworks emphasize that any scientific evidence requires making at least one comparison . For MPN_575 experiments, controls should include:

    • Vehicle control (buffer alone)

    • Irrelevant protein control (similarly produced recombinant protein)

    • Wild-type vs. knockout studies in M. pneumoniae (if feasible)

  • Employ multiple methodological approaches:

    • Subcellular localization studies

    • Protein-protein interaction assays (pull-downs, Y2H, BioID)

    • Functional assays based on predicted properties

    • Structural studies (crystallography, cryo-EM)

  • Address threats to validity - Consider the 12 common threats to valid inference outlined in experimental design theory, particularly instrumentation effects, selection bias, and regression artifacts when analyzing results .

The experiment should be structured as a true experimental design rather than pre-experimental or quasi-experimental design to maximize internal validity .

What are the optimal storage and handling conditions for recombinant MPN_575?

Proper storage and handling are critical for maintaining protein integrity and experimental reproducibility:

ConditionRecommendationNotes
Long-term Storage-20°C to -80°CShelf life: 12 months (lyophilized), 6 months (liquid)
Working aliquots4°CFor up to one week
Freeze-thaw cyclesAvoid repeated cyclesPrepare single-use aliquots
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdd 5-50% glycerol (final concentration)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains stability
Pre-use preparationBrief centrifugationBrings contents to bottom of vial

It is recommended to centrifuge the vial briefly prior to opening to ensure all material is at the bottom of the tube. When reconstituting, the addition of glycerol (typically to a final concentration of 50%) helps prevent freeze-thaw damage .

How can researchers investigate MPN_575's potential role in Mycoplasma pneumoniae pathogenesis?

Investigating MPN_575's role in pathogenesis requires a systematic research approach:

  • Comparative expression analysis:

    • Measure MPN_575 expression levels during different growth phases

    • Compare expression in clinical isolates with varying virulence

    • Analyze expression during interaction with host cells

  • Host-pathogen interaction studies:

    • Use purified recombinant MPN_575 to assess direct effects on host cells

    • Identify potential host cell receptors or interaction partners

    • Evaluate immune response to MPN_575 (antibody production, cytokine induction)

  • Genetic manipulation approaches:

    • Generate knockout or knockdown strains (if technically feasible)

    • Create overexpression strains

    • Introduce site-directed mutations in conserved regions

  • Clinical correlation studies:

    • Compare MPN_575 sequence variants in clinical isolates

    • Assess correlation with disease severity or specific clinical presentations

    • Investigate association with macrolide resistance, as this is a significant research focus in M. pneumoniae

Recent research on M. pneumoniae has focused heavily on macrolide resistance mechanisms, biomarkers for refractory M. pneumoniae pneumonia (RMPP), and molecular typing of resistant strains . Investigating if MPN_575 plays any role in these processes could be particularly valuable.

What methodologies are recommended for structural characterization of MPN_575?

For structural characterization of this uncharacterized protein, researchers should consider:

  • Secondary structure prediction and analysis:

    • Circular dichroism (CD) spectroscopy

    • Fourier-transform infrared spectroscopy (FTIR)

    • In silico prediction tools (PSIPRED, JPred)

  • Tertiary structure determination:

    • X-ray crystallography (may require optimization of crystallization conditions)

    • Nuclear magnetic resonance (NMR) spectroscopy (if protein size permits)

    • Cryo-electron microscopy (cryo-EM) for membrane-associated conformations

  • Membrane interaction studies (given the hydrophobic regions):

    • Liposome binding assays

    • Membrane insertion assays

    • Detergent solubility profiling

  • Computational approaches:

    • Homology modeling (if suitable templates exist)

    • Molecular dynamics simulations

    • AlphaFold or similar AI-based prediction methods

How does MPN_575 research fit within current Mycoplasma pneumoniae research trends?

Research on MPN_575 should be contextualized within broader M. pneumoniae research trends:

  • Epidemiological significance:

    • M. pneumoniae pneumonia (MPP) occurs in regional outbreaks every 3-7 years

    • Recent significant rise in MP infections among children in China

    • M. pneumoniae accounts for >40% of pediatric community-acquired pneumonia cases during epidemic years

  • Current research hotspots based on bibliometric analysis:

    • Diagnostic techniques for MP

    • Macrolide resistance mechanisms

    • Complications of MPP

    • Treatment and diagnosis of refractory M. pneumoniae pneumonia (RMPP)

    • Elucidation of pathogenic mechanisms

  • Publication trends:

    • China leads global productivity (56.19% of publications)

    • Key research institutions include Soochow University, Capital Medical University, and Zhejiang University

    • Highly cited papers focus on epidemiology, macrolide resistance, and biomarkers

Understanding an uncharacterized protein like MPN_575 could contribute to filling knowledge gaps in M. pneumoniae pathogenesis, potentially addressing why there has been a trend toward younger age of onset for MPP and the rise in cases of refractory pneumonia .

What approaches can help elucidate the function of uncharacterized proteins like MPN_575?

Uncharacterized proteins present unique research challenges requiring integrated approaches:

  • Comparative genomics:

    • Identify orthologs in related species

    • Analyze conservation patterns and evolutionary history

    • Examine genomic context for functional association clues

  • Transcriptomic co-expression analysis:

    • Identify genes with similar expression patterns

    • Determine conditions that induce expression changes

    • Construct gene regulatory networks

  • Protein-protein interaction mapping:

    • Yeast two-hybrid screening

    • Affinity purification-mass spectrometry

    • Protein microarrays using the recombinant protein

  • Phenotypic analysis:

    • Gene knockout/knockdown studies (if technically feasible)

    • Overexpression studies

    • Complementation assays

  • Integration of diverse datasets:

    • Machine learning approaches for function prediction

    • Network analysis to identify functional clusters

    • Literature-based discovery methods

The scientific community increasingly recognizes the importance of characterizing proteins of unknown function, as they may represent novel therapeutic targets or provide insights into fundamental biological processes unique to minimal organisms like M. pneumoniae .

How can researchers validate antibodies against MPN_575 for immunological studies?

Antibody validation is crucial for reliable immunological studies of MPN_575:

  • Initial validation tests:

    • Western blot against recombinant MPN_575 (positive control)

    • Western blot against M. pneumoniae lysates

    • Peptide competition assays to confirm specificity

    • Testing in knockout/knockdown systems (if available)

  • Cross-reactivity assessment:

    • Testing against related species

    • Testing against host proteins when conducting host-pathogen studies

    • Epitope mapping to identify potential cross-reactivity

  • Application-specific validation:

    • For immunofluorescence: Test fixation conditions and include controls

    • For immunoprecipitation: Validate pull-down efficiency and specificity

    • For flow cytometry: Validate with appropriate controls and titrations

  • Reproducibility considerations:

    • Test multiple antibody lots

    • Validate across different biological samples

    • Document detailed protocols for antibody use

Proper validation following these methodological approaches ensures reliable results and minimizes false positive/negative findings in subsequent studies .

What are the critical quality control parameters for recombinant MPN_575 protein preparations?

Quality control is essential for reproducible research with recombinant proteins:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE>85-90% purity
IdentityMass spectrometryMatches predicted MW
N-terminal sequencingConfirms expected sequence
Endotoxin levelsLAL assayApplication-dependent limits
Aggregation stateSize exclusion chromatographyPrimarily monomeric
FunctionalityApplication-specific assaysDepends on hypothesized function
Tag integrityWestern blotIntact His-tag
Batch consistencyComparative analysisConsistent with previous batches

Researchers should perform these quality control tests for each new batch of protein and maintain detailed records of protein characteristics to ensure experimental reproducibility and reliable cross-laboratory comparisons .

How might studying MPN_575 contribute to understanding Mycoplasma pneumoniae pathogenesis mechanisms?

Studying MPN_575 could advance understanding of M. pneumoniae pathogenesis through several potential avenues:

  • Membrane biology insights:

    • The hydrophobic regions in MPN_575 suggest potential membrane association

    • Could contribute to understanding the minimal membrane requirements in this organism

    • May provide insights into membrane-associated virulence mechanisms

  • Host-pathogen interaction studies:

    • Potential role in adhesion to host cells

    • Possible immunomodulatory effects

    • Contribution to persistence in the host

  • Therapeutic target exploration:

    • Novel target for anti-Mycoplasma therapeutics

    • Possible vaccine candidate if surface-exposed

    • Diagnostic biomarker potential

  • Basic biology of minimal organisms:

    • Understanding essential functions in organisms with minimal genomes

    • Insights into protein moonlighting (multiple functions)

    • Evolution of specialized functions in reduced genomes

These directions align with current research trends in M. pneumoniae, which focus on understanding pathogenic mechanisms, macrolide resistance, and finding biomarkers for refractory M. pneumoniae pneumonia .

What data management strategies are recommended for MPN_575 characterization research?

Effective data management is crucial for research reproducibility and maximizing research impact:

  • Experimental data recording:

    • Maintain detailed electronic laboratory notebooks

    • Document all experimental conditions thoroughly

    • Record raw data alongside processed results

    • Implement consistent file naming conventions

  • Data analysis standardization:

    • Use established bioinformatics pipelines

    • Document all analysis parameters

    • Maintain version control for analysis scripts

    • Include positive and negative controls in all analyses

  • Data sharing considerations:

    • Deposit sequence data in appropriate databases (GenBank, UniProt)

    • Share structural data in PDB or similar repositories

    • Consider preregistration of study protocols

    • Prepare data for eventual publication in accordance with FAIR principles

  • Integration with existing knowledge:

    • Systematically compare findings with literature

    • Utilize appropriate ontologies for data annotation

    • Consider how findings address gaps identified in bibliometric analyses

    • Maintain awareness of emerging research trends

Adopting these data management strategies aligns with open research practices that increase transparency and work towards reproducibility, addressing concerns about questionable research practices in biological sciences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.