Recombinant Mycoplasma pneumoniae Uncharacterized Protein MPN_594, denoted as MPN_594, is a protein derived from the bacterium Mycoplasma pneumoniae, a common respiratory pathogen affecting both children and the elderly . This protein is expressed in Escherichia coli (E. coli) and is fused with an N-terminal His tag for purification and identification purposes . Despite being uncharacterized, MPN_594 is of interest in life sciences research due to its potential roles in various biological pathways.
Expression Host: The MPN_594 protein is expressed in E. coli, a common host for recombinant protein production due to its ease of manipulation and high yield .
Tagging: The protein is tagged with an N-terminal His tag, which facilitates affinity purification using nickel or cobalt columns .
Purity: The purified protein has a purity of greater than 90%, as determined by SDS-PAGE, indicating a high level of homogeneity .
Protein Length: The full-length protein consists of 122 amino acids .
Amino Acid Sequence: The sequence begins with MNFSRRSLRVGAIVNVSVRSLLMRGKNRNKCNSIIFLTVGLLLFIAALALGVLVLFNGYQVNVNANGVDLKPFEIVHFPFAVKTFLSVLTFVLAAFGFVCMVASFLYFVSFKKLKPKANSAS .
Storage Conditions: The lyophilized powder should be stored at -20°C or -80°C. Reconstituted protein should be stored at 4°C for up to one week to avoid degradation .
Pathogenicity: Mycoplasma pneumoniae proteins often contribute to the bacterium's ability to adhere to and invade host cells, potentially implicating MPN_594 in similar processes .
Vaccine Development: Although not directly linked to MPN_594, research on Mycoplasma pneumoniae proteins highlights the importance of understanding their functions for developing effective vaccines .
KEGG: mpn:MPN594
MPN_594 is an uncharacterized protein from Mycoplasma pneumoniae, a small pathogenic bacterium that causes respiratory infections. The full-length protein consists of 122 amino acids, and while classified as "uncharacterized," it represents an important target for understanding M. pneumoniae biology . The protein's relatively small size is consistent with the minimalist genome of M. pneumoniae, which has undergone evolutionary reduction as an adaptation to its parasitic lifestyle.
E. coli expression systems have been successfully employed to produce recombinant MPN_594 with His-tag modifications . The bacterial expression platform provides several advantages for MPN_594 production, including rapid growth, high protein yields, and compatibility with the protein's structural requirements. When expressing MPN_594, researchers typically use T7 RNA polymerase-based systems with inducible promoters to control expression timing and intensity.
Within the compact 816 kb genome of M. pneumoniae, each protein plays significant roles in cellular function due to the organism's limited genetic repertoire. While specific genomic context information for MPN_594 is limited in current literature, comprehensive genome sequencing projects have achieved nearly 100% coverage of the M. pneumoniae reference genome (99.89% for strain M129) . MPN_594's contribution to the organism's minimal gene set suggests functional importance despite being uncharacterized.
The His-tagged version of recombinant MPN_594 enables efficient purification through immobilized metal affinity chromatography (IMAC) . For research applications requiring exceptionally high purity, a multi-step purification protocol is recommended:
Initial IMAC purification using Ni-NTA resin
Secondary size-exclusion chromatography to remove aggregates
Optional ion exchange chromatography step for removal of endotoxins and nucleic acid contaminants
This approach typically yields protein preparations with >95% purity suitable for structural and functional studies.
Although MPN_594 remains uncharacterized, computational analyses can provide valuable insights. Based on proteins with similar sequence profiles in M. pneumoniae, predictive algorithms suggest possible functional roles. While specific domain data for MPN_594 is not directly reported in the available literature, analysis of the M. pneumoniae proteome has identified that approximately 75% of its proteins (396 out of 528 quantified proteins) have assigned functions . The remaining uncharacterized proteins like MPN_594 may represent novel functional domains unique to this minimal organism.
Translation efficiency studies in M. pneumoniae provide a framework for understanding protein expression patterns, though MPN_594-specific data is limited. Quantitative proteomics approaches have determined that the total protein count per M. pneumoniae cell ranges between 1.15×10^5 and 1.54×10^5 copies, averaging 1.207×10^5 copies per cell across all samples . Researchers investigating MPN_594 expression patterns should consider:
Ribosome profiling to assess translational efficiency
Label-free mass spectrometry for absolute quantification
RNA-seq to correlate transcript and protein abundance
These methodologies provide complementary data to characterize expression patterns under various conditions.
The interactome of M. pneumoniae represents a complex network of protein-protein interactions crucial for cellular processes. While specific interacting partners for MPN_594 are not explicitly detailed in the available literature, researchers have employed several techniques to map protein interactions in this organism:
Yeast two-hybrid screening
Co-immunoprecipitation coupled with mass spectrometry
When investigating potential MPN_594 interactions, researchers should consider both direct binding partners and participation in larger protein complexes that may reveal functional significance.
Genome comparison studies of M. pneumoniae isolates provide insight into protein conservation patterns. Analysis of reference strains (M129, FH, R003) and clinical isolates has demonstrated high genomic conservation, with genome coverage percentages exceeding 99% when aligned to reference genomes . The following table summarizes sequence conservation across selected strains:
| Strain/Sample ID | Source Type | Genome Size (bp) | Subtype | M129 Genome Coverage (%) |
|---|---|---|---|---|
| M129 | Reference | 802,479 | 1 | 99.89 |
| FH | Reference | 803,911 | 2 | 99.29 |
| R003 | Reference | 800,612 | 2 | 99.21 |
| B174 | Asymptomatic | 805,944 | 1 | 99.83 |
| B247 | Asymptomatic | 801,799 | 1 | 99.63 |
This high conservation suggests that MPN_594 likely maintains sequence integrity across strains, though subtle variations may exist between subtype 1 and subtype 2 strains that could impact protein function .
Based on general principles for recombinant protein handling and specific requirements for M. pneumoniae proteins, the following buffer conditions are recommended for MPN_594:
Purification Buffer:
50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)
150-300 mM NaCl
10% glycerol as stabilizer
1 mM DTT or 2 mM β-mercaptoethanol to maintain reduced state
Protease inhibitor cocktail
Storage Buffer:
20 mM Tris-HCl (pH 7.5)
150 mM NaCl
15-20% glycerol
Storage at -80°C in small aliquots to prevent freeze-thaw cycles
Researchers should validate these conditions empirically, as the uncharacterized nature of MPN_594 may require customized buffer optimization.
For generating antibodies against uncharacterized proteins like MPN_594, a multi-epitope approach is recommended:
Recombinant Protein Immunization:
Use full-length His-tagged recombinant MPN_594 expressed in E. coli
Employ a prime-boost immunization protocol in rabbits or mice
Verify antibody specificity against both recombinant protein and native M. pneumoniae lysates
Synthetic Peptide Approach:
Identify 2-3 antigenic epitopes through computational prediction
Synthesize KLH-conjugated peptides for immunization
Pool resulting antibodies to increase detection sensitivity
Validation Methods:
Western blot against both recombinant and native protein
Immunoprecipitation efficiency testing
Immunofluorescence localization in M. pneumoniae cells
This comprehensive approach increases the likelihood of generating specific and functional antibodies against this uncharacterized protein.
Given the uncharacterized nature of MPN_594, a systematic screening approach is necessary to identify potential enzymatic functions:
Sequence-Based Activity Prediction:
Employ bioinformatic tools to predict potential catalytic sites
Search for distant homologs with known functions
Identify conserved motifs that suggest enzymatic categories
Activity Screening Panel:
Test hydrolase activities (esterase, protease, phosphatase)
Examine transferase functions (kinase, methyltransferase)
Assess redox activities (oxidoreductase properties)
Substrate Specificity Determination:
For identified activity classes, screen substrate panels
Determine kinetic parameters (Km, Vmax, kcat)
Characterize pH and temperature optima
This methodical approach provides comprehensive functional characterization beyond simple annotation efforts.
Multi-omics data integration provides deeper insights into MPN_594 regulation. Based on established M. pneumoniae research approaches, the following integration framework is recommended:
Correlation Analysis:
Calculate Pearson or Spearman correlation coefficients between mRNA and protein abundance
Account for temporal delays between transcription and translation
Identify potential post-transcriptional regulation
Pathway Contextualization:
Map MPN_594 expression patterns to known M. pneumoniae metabolic pathways
Identify co-regulated genes through clustering analyses
Infer potential functional associations from co-expression patterns
Translation Efficiency Calculation:
This integrated approach leverages established quantitative frameworks in M. pneumoniae research to position MPN_594 within the broader cellular context.
For uncharacterized proteins like MPN_594, a comprehensive bioinformatic workflow should include:
Sequence-Based Analysis:
Profile-based searches (PSI-BLAST, HMMER)
Secondary structure prediction (PSIPRED, JPred)
Disorder prediction (PONDR, IUPred)
Transmembrane topology assessment
Structural Prediction:
Template-based modeling (SWISS-MODEL, Phyre2)
Ab initio modeling for unique regions (ROSETTA, AlphaFold)
Active site prediction (3DLigandSite, CASTp)
Genomic Context Analysis:
Examine neighboring genes in the M. pneumoniae genome
Identify potential operonic structures
Apply phylogenetic profiling across mycoplasma species
Network Integration:
Protein-protein interaction prediction
Metabolic network positioning
Essentiality prediction based on genomic data
This multi-layered approach provides complementary lines of evidence to generate testable hypotheses about MPN_594 function.
When facing contradictory experimental outcomes, researchers should implement a systematic reconciliation framework:
Methodological Evaluation:
Compare experimental conditions in detail (buffers, temperatures, reagent sources)
Assess validity of controls and statistical approaches
Consider protein preparation differences (tags, purification methods)
Biological Context Consideration:
Integrative Validation:
Design experiments that directly address contradictions
Employ orthogonal techniques to validate key findings
Consider native vs. recombinant protein differences
Collaborative Resolution:
Initiate material exchange between laboratories
Standardize protocols across research groups
Conduct parallel experiments with identical conditions
This structured approach transforms contradictory results into opportunities for deeper mechanistic understanding.
For structural characterization of MPN_594, researchers should consider these complementary approaches:
X-ray Crystallography:
Optimize recombinant expression for high yield (10-15 mg/L culture)
Screen extensive crystallization conditions (vapor diffusion, batch methods)
Consider surface entropy reduction mutations to promote crystallization
NMR Spectroscopy:
Express isotopically labeled protein (15N, 13C)
Collect multidimensional spectra for backbone assignment
Ideal for detecting dynamically disordered regions
Cryo-Electron Microscopy:
Particularly valuable if MPN_594 forms complexes
Consider GraFix method for stabilizing transient complexes
Complement with cross-linking mass spectrometry
Integrative Structural Biology:
Combine lower-resolution techniques (SAXS, CD spectroscopy)
Validate computational models with experimental constraints
Apply distance measurements (FRET, paramagnetic relaxation)
Each approach offers distinct advantages, and their combination provides comprehensive structural insights.
Genetic manipulation of M. pneumoniae presents unique challenges due to its minimal genome. The following approaches are recommended for MPN_594 functional studies:
Targeted Gene Disruption:
Employ transposon mutagenesis with mini-transposons
Screen for viable mutants with insertions in MPN_594
Characterize phenotypic consequences comprehensively
Controlled Expression Systems:
Develop tetracycline-responsive promoters for M. pneumoniae
Generate conditional knockdown strains
Monitor growth and morphological changes using microscopy
Tagging Strategies:
Create C-terminal fusions that preserve function
Employ split-protein complementation for interaction studies
Validate tag effect on protein function biochemically
Complementation Analysis:
Reintroduce wild-type or mutant versions at ectopic locations
Assess rescue of phenotypes in disruption strains
Perform structure-function relationship studies
These approaches balance technical feasibility with scientific rigor for studying this challenging bacterial system.
Understanding MPN_594's role in pathogenesis requires investigation across multiple dimensions:
Expression Pattern Analysis:
Compare expression between asymptomatic carrier strains and clinical isolates
Analyze regulation during infection models
Examine stress-induced expression changes
Host Interaction Studies:
Screen for binding to host extracellular matrix components
Assess immunogenicity and antigenic properties
Investigate potential immunomodulatory functions
Comparative Genomics Approach:
Functional Infection Models:
Evaluate adherence to respiratory epithelial cells
Measure inflammatory response induction
Assess contribution to colonization persistence
This multifaceted investigation connects molecular mechanisms to clinically relevant outcomes.