Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_594 (MPN_594)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycoplasma pneumoniae Uncharacterized Protein MPN_594

Recombinant Mycoplasma pneumoniae Uncharacterized Protein MPN_594, denoted as MPN_594, is a protein derived from the bacterium Mycoplasma pneumoniae, a common respiratory pathogen affecting both children and the elderly . This protein is expressed in Escherichia coli (E. coli) and is fused with an N-terminal His tag for purification and identification purposes . Despite being uncharacterized, MPN_594 is of interest in life sciences research due to its potential roles in various biological pathways.

2.1. Expression and Purification

  • Expression Host: The MPN_594 protein is expressed in E. coli, a common host for recombinant protein production due to its ease of manipulation and high yield .

  • Tagging: The protein is tagged with an N-terminal His tag, which facilitates affinity purification using nickel or cobalt columns .

  • Purity: The purified protein has a purity of greater than 90%, as determined by SDS-PAGE, indicating a high level of homogeneity .

2.2. Physical and Chemical Properties

  • Protein Length: The full-length protein consists of 122 amino acids .

  • Amino Acid Sequence: The sequence begins with MNFSRRSLRVGAIVNVSVRSLLMRGKNRNKCNSIIFLTVGLLLFIAALALGVLVLFNGYQVNVNANGVDLKPFEIVHFPFAVKTFLSVLTFVLAAFGFVCMVASFLYFVSFKKLKPKANSAS .

  • Storage Conditions: The lyophilized powder should be stored at -20°C or -80°C. Reconstituted protein should be stored at 4°C for up to one week to avoid degradation .

3.1. Potential Pathways and Roles

  • Pathogenicity: Mycoplasma pneumoniae proteins often contribute to the bacterium's ability to adhere to and invade host cells, potentially implicating MPN_594 in similar processes .

  • Vaccine Development: Although not directly linked to MPN_594, research on Mycoplasma pneumoniae proteins highlights the importance of understanding their functions for developing effective vaccines .

References Creative BioMart. Recombinant Full Length Mycoplasma pneumoniae Uncharacterized Protein MPN_594 (MPN_594) Protein, His-Tagged. Research of recombinant influenza A virus as a vector for Mycoplasma pneumoniae vaccine development. Exploring the pathogenetic mechanisms of Mycoplasma pneumoniae infection. Recombinant Mycoplasma pneumoniae Uncharacterized protein MG2181 homolog MPN311. The Mycoplasma pneumoniae MPN229 gene encodes a protein that selectively binds single-stranded DNA. Antibody Response to Mycoplasma pneumoniae: Protection of Host. Mycoplasma pneumoniae from the Respiratory Tract and Beyond. Mycoplasma pneumoniae infection: Basics. Creative BioMart. mpn_594 - Creative BioMart.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MPN_594; D02_orf122A; MP248; Uncharacterized protein MPN_594
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_594
Target Protein Sequence
MNFSRRSLRVGAIVNVSVRSLLMRGKNRNKCNSIIFLTVGLLLFIAALALGVLVLFNGYQ VNVNANGVDLKPFEIVHFPFAVKTFLSVLTFVLAAFGFVCMVASFLYFVSFKKLKPKANS AS
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN594

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_594 and what are its basic structural characteristics?

MPN_594 is an uncharacterized protein from Mycoplasma pneumoniae, a small pathogenic bacterium that causes respiratory infections. The full-length protein consists of 122 amino acids, and while classified as "uncharacterized," it represents an important target for understanding M. pneumoniae biology . The protein's relatively small size is consistent with the minimalist genome of M. pneumoniae, which has undergone evolutionary reduction as an adaptation to its parasitic lifestyle.

What expression systems are most effective for producing recombinant MPN_594?

E. coli expression systems have been successfully employed to produce recombinant MPN_594 with His-tag modifications . The bacterial expression platform provides several advantages for MPN_594 production, including rapid growth, high protein yields, and compatibility with the protein's structural requirements. When expressing MPN_594, researchers typically use T7 RNA polymerase-based systems with inducible promoters to control expression timing and intensity.

How does MPN_594 fit within the genomic context of Mycoplasma pneumoniae?

Within the compact 816 kb genome of M. pneumoniae, each protein plays significant roles in cellular function due to the organism's limited genetic repertoire. While specific genomic context information for MPN_594 is limited in current literature, comprehensive genome sequencing projects have achieved nearly 100% coverage of the M. pneumoniae reference genome (99.89% for strain M129) . MPN_594's contribution to the organism's minimal gene set suggests functional importance despite being uncharacterized.

What purification approaches yield highest purity for recombinant MPN_594?

The His-tagged version of recombinant MPN_594 enables efficient purification through immobilized metal affinity chromatography (IMAC) . For research applications requiring exceptionally high purity, a multi-step purification protocol is recommended:

  • Initial IMAC purification using Ni-NTA resin

  • Secondary size-exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography step for removal of endotoxins and nucleic acid contaminants

This approach typically yields protein preparations with >95% purity suitable for structural and functional studies.

What functional domains or motifs have been predicted in MPN_594 through computational approaches?

Although MPN_594 remains uncharacterized, computational analyses can provide valuable insights. Based on proteins with similar sequence profiles in M. pneumoniae, predictive algorithms suggest possible functional roles. While specific domain data for MPN_594 is not directly reported in the available literature, analysis of the M. pneumoniae proteome has identified that approximately 75% of its proteins (396 out of 528 quantified proteins) have assigned functions . The remaining uncharacterized proteins like MPN_594 may represent novel functional domains unique to this minimal organism.

How does MPN_594 expression vary across different growth conditions in M. pneumoniae?

Translation efficiency studies in M. pneumoniae provide a framework for understanding protein expression patterns, though MPN_594-specific data is limited. Quantitative proteomics approaches have determined that the total protein count per M. pneumoniae cell ranges between 1.15×10^5 and 1.54×10^5 copies, averaging 1.207×10^5 copies per cell across all samples . Researchers investigating MPN_594 expression patterns should consider:

  • Ribosome profiling to assess translational efficiency

  • Label-free mass spectrometry for absolute quantification

  • RNA-seq to correlate transcript and protein abundance

These methodologies provide complementary data to characterize expression patterns under various conditions.

What protein-protein interactions involve MPN_594 within the M. pneumoniae interactome?

The interactome of M. pneumoniae represents a complex network of protein-protein interactions crucial for cellular processes. While specific interacting partners for MPN_594 are not explicitly detailed in the available literature, researchers have employed several techniques to map protein interactions in this organism:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation coupled with mass spectrometry

  • Pull-down assays using recombinant tagged proteins

When investigating potential MPN_594 interactions, researchers should consider both direct binding partners and participation in larger protein complexes that may reveal functional significance.

How do strain variations affect MPN_594 sequence conservation across clinical and reference isolates?

Genome comparison studies of M. pneumoniae isolates provide insight into protein conservation patterns. Analysis of reference strains (M129, FH, R003) and clinical isolates has demonstrated high genomic conservation, with genome coverage percentages exceeding 99% when aligned to reference genomes . The following table summarizes sequence conservation across selected strains:

Strain/Sample IDSource TypeGenome Size (bp)SubtypeM129 Genome Coverage (%)
M129Reference802,479199.89
FHReference803,911299.29
R003Reference800,612299.21
B174Asymptomatic805,944199.83
B247Asymptomatic801,799199.63

This high conservation suggests that MPN_594 likely maintains sequence integrity across strains, though subtle variations may exist between subtype 1 and subtype 2 strains that could impact protein function .

What are the optimal buffer conditions for maintaining MPN_594 stability during purification and storage?

Based on general principles for recombinant protein handling and specific requirements for M. pneumoniae proteins, the following buffer conditions are recommended for MPN_594:

Purification Buffer:

  • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 10% glycerol as stabilizer

  • 1 mM DTT or 2 mM β-mercaptoethanol to maintain reduced state

  • Protease inhibitor cocktail

Storage Buffer:

  • 20 mM Tris-HCl (pH 7.5)

  • 150 mM NaCl

  • 15-20% glycerol

  • Storage at -80°C in small aliquots to prevent freeze-thaw cycles

Researchers should validate these conditions empirically, as the uncharacterized nature of MPN_594 may require customized buffer optimization.

What antibody development strategies are most effective for generating specific anti-MPN_594 antibodies?

For generating antibodies against uncharacterized proteins like MPN_594, a multi-epitope approach is recommended:

  • Recombinant Protein Immunization:

    • Use full-length His-tagged recombinant MPN_594 expressed in E. coli

    • Employ a prime-boost immunization protocol in rabbits or mice

    • Verify antibody specificity against both recombinant protein and native M. pneumoniae lysates

  • Synthetic Peptide Approach:

    • Identify 2-3 antigenic epitopes through computational prediction

    • Synthesize KLH-conjugated peptides for immunization

    • Pool resulting antibodies to increase detection sensitivity

  • Validation Methods:

    • Western blot against both recombinant and native protein

    • Immunoprecipitation efficiency testing

    • Immunofluorescence localization in M. pneumoniae cells

This comprehensive approach increases the likelihood of generating specific and functional antibodies against this uncharacterized protein.

What are the recommended protocols for assessing potential enzymatic activities of MPN_594?

Given the uncharacterized nature of MPN_594, a systematic screening approach is necessary to identify potential enzymatic functions:

  • Sequence-Based Activity Prediction:

    • Employ bioinformatic tools to predict potential catalytic sites

    • Search for distant homologs with known functions

    • Identify conserved motifs that suggest enzymatic categories

  • Activity Screening Panel:

    • Test hydrolase activities (esterase, protease, phosphatase)

    • Examine transferase functions (kinase, methyltransferase)

    • Assess redox activities (oxidoreductase properties)

  • Substrate Specificity Determination:

    • For identified activity classes, screen substrate panels

    • Determine kinetic parameters (Km, Vmax, kcat)

    • Characterize pH and temperature optima

This methodical approach provides comprehensive functional characterization beyond simple annotation efforts.

How should researchers integrate transcriptomic and proteomic data to understand MPN_594 expression regulation?

Multi-omics data integration provides deeper insights into MPN_594 regulation. Based on established M. pneumoniae research approaches, the following integration framework is recommended:

  • Correlation Analysis:

    • Calculate Pearson or Spearman correlation coefficients between mRNA and protein abundance

    • Account for temporal delays between transcription and translation

    • Identify potential post-transcriptional regulation

  • Pathway Contextualization:

    • Map MPN_594 expression patterns to known M. pneumoniae metabolic pathways

    • Identify co-regulated genes through clustering analyses

    • Infer potential functional associations from co-expression patterns

  • Translation Efficiency Calculation:

    • Normalize protein abundance (approximately 10^5 copies per cell) against transcript levels

    • Calculate translation efficiency ratios across conditions

    • Compare MPN_594 translation efficiency against established M. pneumoniae proteins

This integrated approach leverages established quantitative frameworks in M. pneumoniae research to position MPN_594 within the broader cellular context.

What bioinformatic approaches are most informative for predicting MPN_594 function?

For uncharacterized proteins like MPN_594, a comprehensive bioinformatic workflow should include:

  • Sequence-Based Analysis:

    • Profile-based searches (PSI-BLAST, HMMER)

    • Secondary structure prediction (PSIPRED, JPred)

    • Disorder prediction (PONDR, IUPred)

    • Transmembrane topology assessment

  • Structural Prediction:

    • Template-based modeling (SWISS-MODEL, Phyre2)

    • Ab initio modeling for unique regions (ROSETTA, AlphaFold)

    • Active site prediction (3DLigandSite, CASTp)

  • Genomic Context Analysis:

    • Examine neighboring genes in the M. pneumoniae genome

    • Identify potential operonic structures

    • Apply phylogenetic profiling across mycoplasma species

  • Network Integration:

    • Protein-protein interaction prediction

    • Metabolic network positioning

    • Essentiality prediction based on genomic data

This multi-layered approach provides complementary lines of evidence to generate testable hypotheses about MPN_594 function.

How should conflicting experimental results regarding MPN_594 function be reconciled?

When facing contradictory experimental outcomes, researchers should implement a systematic reconciliation framework:

  • Methodological Evaluation:

    • Compare experimental conditions in detail (buffers, temperatures, reagent sources)

    • Assess validity of controls and statistical approaches

    • Consider protein preparation differences (tags, purification methods)

  • Biological Context Consideration:

    • Evaluate strain variations (subtype 1 vs. subtype 2)

    • Consider growth phase and culture conditions

    • Assess potential post-translational modifications

  • Integrative Validation:

    • Design experiments that directly address contradictions

    • Employ orthogonal techniques to validate key findings

    • Consider native vs. recombinant protein differences

  • Collaborative Resolution:

    • Initiate material exchange between laboratories

    • Standardize protocols across research groups

    • Conduct parallel experiments with identical conditions

This structured approach transforms contradictory results into opportunities for deeper mechanistic understanding.

What are the most promising approaches for determining the three-dimensional structure of MPN_594?

For structural characterization of MPN_594, researchers should consider these complementary approaches:

  • X-ray Crystallography:

    • Optimize recombinant expression for high yield (10-15 mg/L culture)

    • Screen extensive crystallization conditions (vapor diffusion, batch methods)

    • Consider surface entropy reduction mutations to promote crystallization

  • NMR Spectroscopy:

    • Express isotopically labeled protein (15N, 13C)

    • Collect multidimensional spectra for backbone assignment

    • Ideal for detecting dynamically disordered regions

  • Cryo-Electron Microscopy:

    • Particularly valuable if MPN_594 forms complexes

    • Consider GraFix method for stabilizing transient complexes

    • Complement with cross-linking mass spectrometry

  • Integrative Structural Biology:

    • Combine lower-resolution techniques (SAXS, CD spectroscopy)

    • Validate computational models with experimental constraints

    • Apply distance measurements (FRET, paramagnetic relaxation)

Each approach offers distinct advantages, and their combination provides comprehensive structural insights.

How might genetic manipulation systems be optimized for studying MPN_594 function in vivo?

Genetic manipulation of M. pneumoniae presents unique challenges due to its minimal genome. The following approaches are recommended for MPN_594 functional studies:

  • Targeted Gene Disruption:

    • Employ transposon mutagenesis with mini-transposons

    • Screen for viable mutants with insertions in MPN_594

    • Characterize phenotypic consequences comprehensively

  • Controlled Expression Systems:

    • Develop tetracycline-responsive promoters for M. pneumoniae

    • Generate conditional knockdown strains

    • Monitor growth and morphological changes using microscopy

  • Tagging Strategies:

    • Create C-terminal fusions that preserve function

    • Employ split-protein complementation for interaction studies

    • Validate tag effect on protein function biochemically

  • Complementation Analysis:

    • Reintroduce wild-type or mutant versions at ectopic locations

    • Assess rescue of phenotypes in disruption strains

    • Perform structure-function relationship studies

These approaches balance technical feasibility with scientific rigor for studying this challenging bacterial system.

What is the potential significance of MPN_594 in M. pneumoniae pathogenesis?

Understanding MPN_594's role in pathogenesis requires investigation across multiple dimensions:

  • Expression Pattern Analysis:

    • Compare expression between asymptomatic carrier strains and clinical isolates

    • Analyze regulation during infection models

    • Examine stress-induced expression changes

  • Host Interaction Studies:

    • Screen for binding to host extracellular matrix components

    • Assess immunogenicity and antigenic properties

    • Investigate potential immunomodulatory functions

  • Comparative Genomics Approach:

    • Analyze conservation across strains associated with different clinical presentations

    • Compare sequence in reference (M129, FH, R003) versus clinical isolates

    • Identify potential virulence-associated polymorphisms

  • Functional Infection Models:

    • Evaluate adherence to respiratory epithelial cells

    • Measure inflammatory response induction

    • Assess contribution to colonization persistence

This multifaceted investigation connects molecular mechanisms to clinically relevant outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.