Recombinant Mycoplasma pulmonis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; MYPU_2700; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Mycoplasma pulmonis (strain UAB CTIP)
Target Names
atpF
Target Protein Sequence
MNFGANLLTNYNEELTEKFYRLFPSIPLMLATLAALVISIFFLTYFFYKPIRKNIKKRKQ YIQDNIDAANKLKQQSLENLEESNKKLNEAREQASEIINSSKRDAELIVINYKMSAQKKS EEILKKAQLEIKRKEEEFLRTSREEIIDAATIIAKKILIKEIDSNYEKKIIDDISFDSEK
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Mycoplasma pulmonis and what is its biological significance?

ATP synthase subunit b (atpF) is a membrane-associated protein component of the F0 sector of ATP synthase in Mycoplasma pulmonis. This protein is critical for energy metabolism in M. pulmonis, which is a respiratory pathogen known to infect laboratory rodents. The protein is encoded by the atpF gene (locus tag MYPU_2700) and consists of 180 amino acids in its full-length form .

As a component of ATP synthase, atpF plays a crucial role in the bacterial ATP synthesis process, which is especially important considering that M. pulmonis has limited metabolic pathways due to its small genome size (963,879 bp with a G+C content of only 26.6%) . ATP synthase in mycoplasmas represents one of the few energy-generating systems in these organisms, which lack many of the metabolic pathways found in other bacteria.

What are the optimal conditions for expressing recombinant M. pulmonis atpF in E. coli expression systems?

For optimal expression of recombinant M. pulmonis atpF in E. coli:

  • Vector selection: Expression vectors with strong inducible promoters (T7, tac) are recommended for membrane proteins like atpF.

  • E. coli strain: BL21(DE3) or derivatives optimized for membrane protein expression perform well. Based on data from similar mycoplasma membrane protein expressions, Rosetta or C41/C43(DE3) strains may improve yield by accommodating rare codons present in the mycoplasma genome .

  • Expression conditions:

    • Induce at OD600 0.6-0.8 with 0.1-0.5 mM IPTG

    • Lower induction temperature (16-25°C) improves proper folding

    • Extended expression time (16-24 hours) at lower temperatures

  • Key optimization factors:

    • Codon optimization for E. coli expression

    • Addition of fusion tags (His-tag is commonly used)

    • Addition of solubility enhancers (e.g., fusion with thioredoxin or GST)

Commercially available recombinant M. pulmonis atpF is typically expressed with an N-terminal His-tag in E. coli systems, suggesting these methods have proven successful for research-scale production .

What purification strategies yield the highest purity and retention of native structure for recombinant M. pulmonis atpF?

Purification of recombinant M. pulmonis atpF requires specific strategies to maintain structural integrity while achieving high purity:

Purification StepMethodBuffer CompositionNotes
Initial ExtractionMild detergent solubilizationTris buffer (pH 7.5-8.0) with 0.5-1% Triton X-100 or n-dodecyl β-D-maltosideGentler detergents preserve membrane protein structure
Affinity ChromatographyNi-NTA for His-tagged proteinTris buffer with 150-300 mM NaCl, 20-40 mM imidazoleStepwise elution with increasing imidazole (250-500 mM)
Size ExclusionGel filtrationTris or PBS buffer with 0.05-0.1% detergentRemoves aggregates and purifies monomeric form
StorageFlash freezing aliquotsTris-based buffer with 50% glycerolAvoid repeated freeze-thaw cycles

Critical considerations for maintaining native structure include:

  • Working at 4°C throughout purification

  • Including protease inhibitors

  • Optimizing detergent concentration to prevent aggregation

  • Conducting quality control via SDS-PAGE and Western blotting with anti-His antibodies

Commercially available preparations typically recommend storage at -20°C with avoidance of repeated freeze-thaw cycles, as these can affect protein integrity .

How can recombinant M. pulmonis atpF be utilized for developing serological diagnostic assays?

Recombinant M. pulmonis atpF shows significant potential as a diagnostic antigen, based on successful approaches with similar ATP synthase components in other Mycoplasma species:

  • ELISA development methodology:

    • Coat microplate wells with purified recombinant atpF (5-10 μg/ml)

    • Block with 3-5% BSA or non-fat milk

    • Apply diluted serum samples (1:50 to 1:200)

    • Detect with species-appropriate secondary antibodies

    • Establish cutoff values using known positive and negative control sera

  • Performance optimization:

    • Based on comparable studies with M. pneumoniae AtpD, combining atpF with other mycoplasma antigens (like P46-like lipoprotein) can significantly enhance sensitivity and specificity .

  • Cross-reactivity management:

    • Pre-adsorption of test sera with E. coli lysates can reduce background

    • Species-specific epitopes should be identified and highlighted in assay design

Studies with the P46-like lipoprotein (P46L) from M. pulmonis have shown successful ELISA development with good correlation to commercial assays . Similar approaches would likely be effective with atpF, particularly since ATP synthase components have been demonstrated as immunogenic in M. pneumoniae infections .

What is the potential of M. pulmonis atpF as a target for antimicrobial development?

M. pulmonis atpF represents a promising target for novel antimicrobial development based on several factors:

  • Essential cellular function: ATP synthase is critical for energy metabolism in mycoplasmas, which have limited metabolic pathways due to their reduced genomes . Targeting this enzyme complex could effectively disrupt bacterial viability.

  • Antimicrobial resistance concerns: M. pulmonis, like other mycoplasmas, is intrinsically resistant to β-lactam antibiotics due to the lack of a cell wall . The emergence of resistance to macrolides and other antimicrobials necessitates new targets for antibiotic development.

  • Potential approaches for targeting atpF:

    • Small molecule inhibitors disrupting ATP synthase assembly

    • Peptide mimetics interfering with subunit interactions

    • Antibody-based therapeutics binding to exposed protein regions

  • Screening methodologies:

    • In vitro enzymatic assays measuring ATP synthesis inhibition

    • Bacterial growth inhibition assays

    • Molecular docking studies to identify potential binding sites

Research on antimicrobial peptides against M. pulmonis has shown promising results , suggesting that membrane-associated proteins like atpF could be effective targets. Additionally, the successful targeting of ATP synthase in other pathogens provides precedent for this approach.

What experimental approaches can detect structural changes in atpF during M. pulmonis infection and their impact on host immune response?

Detecting structural changes in atpF during infection requires sophisticated methodological approaches:

  • Structural analysis techniques:

    • Hydrogen/deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes

    • Cryo-electron microscopy of isolated ATP synthase complexes from infected vs. uninfected samples

    • Circular dichroism spectroscopy to monitor secondary structure alterations

  • Post-translational modification analysis:

    • Phosphoproteomics to detect infection-induced phosphorylation

    • Mass spectrometry to identify potential glycosylation or lipidation

    • Western blotting with modification-specific antibodies

  • Host immune response correlation:

    • B-cell epitope mapping using peptide arrays with sera from infected animals

    • T-cell response assessment using recombinant atpF fragments

    • Cytokine profiling in response to native vs. modified atpF

  • In vivo infection models:

    • Time-course analysis in pathogen-free mice using intranasal inoculation with M. pulmonis (similar to the model described in )

    • Sampling at different infection stages (early, peak, resolution)

    • Correlation of atpF structural changes with disease severity markers

The experimental M. pulmonis infection model in pathogen-free mice provides an excellent system for these studies, as it allows controlled infection with defined bacterial doses and systematic analysis of both pathogen and host factors over time.

How can researchers optimize epitope mapping of M. pulmonis atpF for improved serological assays?

Comprehensive epitope mapping of M. pulmonis atpF requires a multi-faceted approach:

  • Computational prediction and analysis:

    • Hydrophilicity plots and surface probability algorithms

    • B-cell epitope prediction tools (BepiPred, ABCpred)

    • Comparative sequence analysis with other Mycoplasma species to identify species-specific regions

  • Overlapping peptide library methodology:

    • Synthesize 15-20 amino acid peptides with 5-10 residue overlaps spanning the entire atpF sequence

    • ELISA or peptide microarray screening against sera from infected and non-infected animals

    • Validation of reactive peptides using competition assays

  • Alanine scanning mutagenesis:

    • Generate point mutations in identified epitope regions

    • Express mutant proteins using the same E. coli system as wild-type atpF

    • Compare binding affinity and specificity to determine critical residues

  • Conformational epitope analysis:

    • Hydrogen/deuterium exchange mass spectrometry with antibody-bound protein

    • X-ray crystallography or cryo-EM of antibody-antigen complexes

    • Phage display with constrained peptides to mimic conformational epitopes

Epitope mapping of ATP synthase components in M. pneumoniae has identified immunogenic regions that could serve as starting points for investigation in M. pulmonis atpF . The approach combining recombinant AtpD with P1 adhesin for M. pneumoniae diagnostics suggests that identification of specific epitopes in M. pulmonis atpF could similarly improve diagnostic accuracy when combined with other antigens like P46L .

What are the key functional differences between ATP synthase subunit b (atpF) from M. pulmonis and other respiratory bacterial pathogens?

ATP synthase subunit b (atpF) from M. pulmonis exhibits several distinctive features compared to similar proteins in other respiratory pathogens:

FeatureM. pulmonis atpFOther Bacterial PathogensFunctional Implication
Sequence Length180 amino acids Typically 150-230 amino acidsStreamlined structure in Mycoplasma
Membrane TopologySingle transmembrane domainOften multiple transmembrane segmentsSimplified membrane anchoring
Genomic ContextPart of the reduced ATP synthase operonComplete F1F0 ATP synthase operonsAdaptation to minimal genome
Post-translational ModificationsLimited modification capabilitiesMore extensive modificationsReduced regulatory capacity
Antigenic PropertiesHighly immunogenic surface-exposed domainsOften less exposed or immunogenicPotential role in host-pathogen interaction

The minimal genome of M. pulmonis (963,879 bp) has resulted in streamlined proteins that maintain essential functions while eliminating non-critical domains. This is particularly evident in energy metabolism systems like ATP synthase, where M. pulmonis maintains core functionality with simplified components compared to other respiratory pathogens.

Research with the ATP synthase beta subunit (AtpD) in M. pneumoniae demonstrated its utility as a diagnostic antigen , suggesting a similar immunological role for atpF in M. pulmonis infections. This immunogenicity may reflect the surface exposure of certain domains, which differs from many other bacterial pathogens where these components are less accessible to the host immune system.

How does the genetic organization of the atpF gene and ATP synthase operon in M. pulmonis compare to other Mycoplasma species, and what are the implications for gene expression and regulation?

The genetic organization of the ATP synthase operon in M. pulmonis reveals important evolutionary adaptations:

  • Operon structure comparison:

    • M. pulmonis: The atpF gene (MYPU_2700) is part of a reduced ATP synthase operon

    • M. pneumoniae: Contains a complete ATP synthase operon with all subunits present

    • M. genitalium: Shows further reduction in ATP synthase gene complement

    • Non-mycoplasma bacteria: Typically contain the complete atpBEFHAGDC operon

  • Regulatory elements:

    • M. pulmonis genome has a G+C content of only 26.6% , affecting promoter architecture

    • Stress response elements regulated by HrcA have been identified in M. pulmonis , potentially influencing ATP synthase expression

    • The origin of replication (oriC) organization in M. pulmonis differs from other mycoplasmas like M. pneumoniae , potentially affecting gene expression timing

  • Transcriptional organization:

    • Polycistronic mRNA of varying lengths may be produced

    • Transcription termination and processing likely differs from model bacteria

    • Potential for differential regulation of operon components

  • Implications for antimicrobial resistance:

    • Alterations in ATP synthase expression could contribute to adaptation to environmental stresses

    • Regulatory mutations affecting operon expression have been observed in M. pulmonis strains showing resistance to antimicrobial peptides

The unique genetic organization of the ATP synthase operon in M. pulmonis represents adaptation to its minimal genome lifestyle. While maintaining this essential energy metabolism component, M. pulmonis has evolved streamlined genetic organization and regulation mechanisms that differ from both other Mycoplasma species and more complex bacteria.

What are the most common challenges in expressing soluble recombinant M. pulmonis atpF, and how can they be addressed?

Researchers frequently encounter specific challenges when expressing M. pulmonis atpF:

  • Protein misfolding and inclusion body formation:

    • Problem: High-level expression often leads to inclusion bodies

    • Solution: Lower induction temperature (16-20°C), reduce IPTG concentration (0.1-0.2 mM), and extend expression time (16-24 hours)

    • Alternative approach: Inclusion body refolding protocols using gradual dialysis against decreasing concentrations of urea or guanidinium chloride

  • Membrane protein solubility issues:

    • Problem: Poor solubility due to hydrophobic transmembrane regions

    • Solution: Use of fusion partners (GST, MBP, or thioredoxin) to enhance solubility

    • Technical approach: Screen multiple detergents (DDM, LDAO, Triton X-100) for optimal solubilization

  • Codon bias affecting expression efficiency:

    • Problem: The low G+C content (26.6%) of M. pulmonis creates codon usage discrepancies in E. coli

    • Solution: Use codon-optimized synthetic genes or specialized E. coli strains like Rosetta that supply rare tRNAs

  • Protein degradation:

    • Problem: Proteolytic degradation during expression or purification

    • Solution: Addition of protease inhibitors, use of protease-deficient strains, and performing all steps at 4°C

    • Validation: Western blotting to confirm full-length protein expression

A successful strategy reported for similar mycoplasma membrane proteins involves expression with N-terminal His-tags in E. coli systems with subsequent purification using nickel affinity chromatography under conditions that maintain the native-like structure of the membrane protein components .

What quality control methods are essential for validating the structure and function of purified recombinant M. pulmonis atpF?

Comprehensive quality control for recombinant M. pulmonis atpF requires multiple complementary approaches:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (>90% purity standard)

    • Reversed-phase HPLC analysis

    • Mass spectrometry to confirm molecular weight and sequence integrity

  • Identity confirmation:

    • Western blotting with anti-His antibodies or specific anti-atpF antibodies

    • Mass spectrometry peptide mapping

    • N-terminal sequencing to confirm correct processing

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to assess secondary structure

    • Differential scanning fluorimetry to measure thermal stability

    • Size exclusion chromatography to detect aggregation state

  • Functional validation:

    • Binding assays with known interaction partners

    • Immunoreactivity testing with sera from infected animals

    • ATP synthase reconstitution assays (if combined with other subunits)

  • Storage stability monitoring:

    • Repeated analysis after storage at recommended conditions (-20°C, with 50% glycerol)

    • Assessment of freeze-thaw cycle effects

    • Long-term stability testing at different temperatures

When developing recombinant atpF for diagnostic applications, additional quality control measures should include reproducibility testing across multiple batches and cross-reactivity assessment with sera containing antibodies against related Mycoplasma species. These measures ensure that research findings are reliable and that diagnostic applications maintain high sensitivity and specificity.

What novel applications of recombinant M. pulmonis atpF might emerge in mycoplasma research and diagnostics?

Several emerging applications for recombinant M. pulmonis atpF show significant research potential:

  • Multiplex diagnostic platforms:

    • Development of protein microarrays incorporating atpF with other M. pulmonis antigens like P46L

    • Point-of-care lateral flow assays using atpF-specific epitopes

    • Bioinformatic integration of serological data with genomic information for improved diagnostics

  • Structural vaccinology approaches:

    • Identification of protective epitopes within atpF

    • Design of chimeric immunogens combining key epitopes from multiple M. pulmonis antigens

    • Structure-guided engineering of atpF variants with enhanced immunogenicity

  • Host-pathogen interaction studies:

    • Atpf-based affinity purification to identify host cell interaction partners

    • Investigation of atpF role in mycoplasma adhesion and colonization

    • Analysis of atpF in membrane vesicle formation and extracellular release

  • ATP synthase inhibitor development:

    • Structure-based design of specific inhibitors targeting unique features of mycoplasma ATP synthase

    • Development of assays to measure ATP synthase activity in intact mycoplasmas

    • Screening of natural product libraries for novel ATP synthase modulators

The successful use of ATP synthase beta subunit (AtpD) in M. pneumoniae diagnostics provides a strong foundation for similar applications of M. pulmonis atpF, particularly in combination with other antigens for enhanced sensitivity and specificity.

How might CRISPR-Cas and other genetic engineering technologies advance functional studies of atpF in Mycoplasma pulmonis?

Genetic engineering technologies offer promising approaches for atpF functional studies:

  • CRISPR-Cas applications in M. pulmonis:

    • Conditional knockdown systems: As complete deletion may be lethal, inducible repression systems using CRISPRi (dCas9-based repression) could allow controlled attenuation of atpF expression

    • Point mutations: CRISPR-mediated base editing to introduce specific amino acid changes

    • Reporter fusions: Knock-in of fluorescent or affinity tags for tracking atpF localization and interactions

  • OriC-plasmid based genetic tools:

    • Leveraging the M. pulmonis origin of replication (oriC) systems for complementation studies

    • Expression of modified atpF variants from plasmids in wild-type background

    • Site-directed mutagenesis to assess structure-function relationships

  • Transposon mutagenesis approaches:

    • Creation of transposon libraries to identify genetic interactions with atpF

    • Identification of suppressor mutations that compensate for atpF defects

    • Synthetic genetic array analysis to map genetic networks

  • Recombineering techniques:

    • Lambda-Red or RecET-based recombination systems adapted to mycoplasma

    • Seamless genome editing for epitope tagging or domain swapping

    • Construction of chimeric ATP synthases with subunits from different species

These approaches could be applied in the well-established experimental M. pulmonis infection model to correlate genetic modifications with in vivo phenotypes, providing unprecedented insights into the role of atpF in mycoplasma pathogenesis and physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.