Recombinant Mycoplasma pulmonis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

YidC: A Critical Membrane Protein Insertase

YidC is a conserved membrane protein insertase essential for the biogenesis of membrane proteins in bacteria, including those lacking a Sec translocon dependency. It facilitates the integration of hydrophobic transmembrane domains into lipid bilayers, either autonomously or in coordination with the SecYEG machinery .

Functional Roles

  • Membrane Protein Insertion: Catalyzes translocation of Sec-independent proteins (e.g., Pf3 coat protein) .

  • Sec-Dependent Synergy: Collaborates with SecYEG to reduce hydrophobic stress during membrane protein folding .

  • Respiratory Complex Assembly: Involved in biogenesis of energy-transducing complexes (e.g., cytochrome bc1) .

Recombinant YidC Production: Lessons from Mycoplasma penetrans

While no direct reports exist for M. pulmonis YidC, recombinant production strategies from M. penetrans YidC provide a template (Table 1).

Key Production Challenges

  • Membrane Protein Solubility: Requires detergent-free protocols to avoid denaturation .

  • Proper Folding: Critical for functional reconstitution into proteoliposomes .

Functional Insights from Heterologous Systems

Studies on Mycoplasma pneumoniae and E. coli YidC highlight its adaptability in chassis engineering:

  • Sec-Independent Activity: Purified E. coli YidC inserts Pf3 coat protein into proteoliposomes at ~70% efficiency .

  • Signal Peptide Optimization: Mutations in lipoprotein signal peptides (e.g., MPN142) in M. pneumoniae enhance secretion rates, suggesting parallels for YidC-mediated membrane retention .

  • Lipid Interaction: YidC’s hydrophilic cavity may stabilize nascent membrane proteins during insertion .

Gaps and Future Directions for M. pulmonis

Unanswered Questions

  • Species-Specific Activity: Does M. pulmonis YidC exhibit unique substrate preferences compared to M. penetrans or M. pneumoniae?

  • Pathogenicity Link: Could YidC influence virulence factors like Vsa lipoproteins or EPS-I polysaccharide in M. pulmonis ?

Proposed Research Approach

  1. Homology Modeling: Predict M. pulmonis YidC structure using M. penetrans (Q8EU91) as a template.

  2. Functional Assays: Test recombinant M. pulmonis YidC in E. coli or M. pneumoniae chassis for membrane protein insertion.

  3. Pathogenesis Studies: Investigate YidC’s role in processing virulence-associated lipoproteins.

Comparative Analysis of YidC Across Mycoplasma Species

SpeciesKey YidC-Dependent FunctionsExperimental Evidence
M. penetransMembrane protein insertion, recombinant productionPurified protein studies
M. pneumoniaeChassis optimization, lipoprotein secretionSignal peptide mutagenesis
M. pulmonisNot directly reported; inferred from conserved rolesLimited to structural predictions

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; MYPU_1520; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Mycoplasma pulmonis (strain UAB CTIP)
Target Names
yidC
Target Protein Sequence
MKRENRSKKYDYFNSSSNNSNKFSKTNFKKYFKIFKLVVYIFLIGLALTGCIQSFVVQSS PNVGAGLELYPSKDKVAPRVNVYKKEENGYVKDRNINELLKDEQSLQALKDFSKNHNGVY GKTKSSNSALAILEDNTYIDSDGQENKSIIYKDNSGKYLFFNDTLTTYDPINKFTDIYAI GRLTERDSDAIKFRENNPKIIEHLKLFKVSEVPISREYQPNIKFARDFLQALYDKTLKLP VYQNILRADGSKYASFNEFLTSLEKRTTNHLKTQLNKQELSEEDLNSITLSDSESAALNA YLTRVNPLISENGFTGLKKSLNNADDFELVYSQGEKIAQSDYGQIPVVTWGEYWNYGPFY ALLVAPIASFTNWVASAFESGFGIVFAIIVVVVVTRLFIFGLTFKVTFSQYKQQELQGKK AKIDAKYAAYENNKMMKQRKQKEIQDLYKKHNISPIDFVASIAWSSPLFIAVWRVIQSVP VIKSNFFLGVNFSTASYQEILAKNWVYLWVVSLALIVQIISQILPRWLAKKKIKERANVY EMQSYKKNNKTQNIMLIVFMVFTITLQAGVQIYWIIGGLWTIGQTLFVHHFQKTSFFKNR VRPWLDRH
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of YidC in Mycoplasma compared to other bacterial species?

YidC is a membrane protein insertase that threads back-and-forth through the bacterial membrane five times. The protein structure includes transmembrane helices that form a rigid protein core, with polar loop regions that interact with the membrane surface. While the specific structure of M. pulmonis YidC hasn't been fully characterized, studies of E. coli YidC reveal that the transmembrane domain is stabilized by both hydrophobic residues on the exterior (interacting with lipid tails) and polar/charged residues in the cytoplasmic side of the core (engaged in electrostatic or charge-dipole interactions). On the periplasmic side, aromatic residues facilitate stacking and nonpolar dispersion interactions . This structural arrangement is likely conserved across mycoplasma species with species-specific variations that reflect their evolutionary adaptations.

How does the absence of a cell wall in Mycoplasma pulmonis affect YidC function and experimental approaches?

Mycoplasma pulmonis, like all mycoplasmas, is a pleomorphic bacterium lacking a cell wall . This distinctive characteristic creates a unique membrane environment that directly influences YidC function. Without a cell wall, the membrane insertase operates in a more fluid and accessible lipid bilayer, potentially altering its conformational dynamics and interaction patterns with substrate proteins.

For experimental approaches, this cell wall absence provides both advantages and challenges:

AspectImpact on YidC ResearchMethodological Considerations
Membrane isolationEasier extraction of membrane componentsRequires gentler lysis methods to preserve membrane integrity
Protein labelingMore direct access to surface proteinsTechniques like Bolton-Hunter reagent iodination can efficiently label membrane-associated proteins without significant viability loss
Structural analysisFewer interfering componentsMust account for higher membrane fluidity in structural models
Functional assaysDirect assessment of membrane insertionNeed to control osmotic conditions carefully during experiments

What evolutionary insights can be drawn from YidC sequence conservation patterns in Mycoplasma species?

Evolutionary co-variation analysis of YidC provides valuable insights into its functional conservation. Studies on E. coli YidC have utilized multiple sequence alignments to predict contacts between residue pairs, revealing specific helix-helix interaction patterns . For Mycoplasma species, which have undergone reductive evolution resulting in minimal genomes, the conservation of YidC underscores its essential function.

The yidC gene has been identified as sufficiently conserved within Mycoplasma species to serve as a reliable PCR target for species identification, as demonstrated by its successful use in M. hominis detection . This conservation suggests strong selective pressure to maintain proper membrane protein insertion functionality despite genomic reduction. Computational analysis of co-evolving residues can identify critical functional domains that could be targeted for experimental manipulation or therapeutic intervention.

What are the optimal techniques for isolation and purification of native YidC from Mycoplasma pulmonis membranes?

The isolation of pure M. pulmonis membranes containing native YidC requires a methodical approach that preserves protein structure and function. Based on established protocols, researchers should:

  • Perform selective labeling of membrane-associated proteins using iodination with Bolton-Hunter reagent, which efficiently tags surface-exposed proteins without compromising cell viability .

  • Verify surface exposure through differential proteolytic digestion to distinguish truly membrane-associated proteins from cytoplasmic contaminants.

  • Extract membranes using density gradient centrifugation, monitoring purification by tracking the labeled surface proteins as markers.

  • Validate membrane purity through autoradiography of both sodium dodecyl sulfate-PAGE and two-dimensional PAGE to confirm retention of surface proteins in isolated membrane fractions .

This approach yields highly purified membrane preparations that retain native YidC in its physiological lipid environment. For subsequent YidC isolation, affinity chromatography with antibodies against conserved YidC epitopes can be employed, though care must be taken to use mild detergents that preserve protein folding and function.

How can researchers effectively express and detect recombinant YidC in heterologous systems?

For effective expression and detection of recombinant M. pulmonis YidC, researchers should consider:

Expression Optimization:

  • Select appropriate signal peptides for membrane targeting. Research on Mycoplasma pneumoniae has shown that mutations at the P1' position of signal peptide cleavage sites affect but do not abrogate secretion, while increasing hydrophobicity and mutations at the C-terminal of signal peptides enhance secretion efficiency .

  • Test different lipoprotein signal peptides as potential N-terminal anchoring motifs, recognizing that these can exhibit variable retention and secretion rates .

  • Consider the engineered Mycoplasma pneumoniae chassis (Mycochassis) as a potential expression system, which has demonstrated ability to express therapeutic molecules both in vitro and in vivo .

Detection Methods:

  • Develop specific real-time PCR assays targeting the yidC gene, adapting approaches used for M. hominis .

  • Employ two-dimensional polyacrylamide gel electrophoresis followed by autoradiography for visualization of labeled YidC .

  • Use immunoblotting with specific antibodies to detect YidC in membrane fractions, similar to techniques used to identify surface antigens in M. pulmonis .

What are the critical controls needed when performing mutagenesis studies on YidC residues?

When conducting mutagenesis studies on YidC residues, several critical controls are essential:

How can recombinant YidC be engineered to enhance heterologous protein secretion or membrane insertion in Mycoplasma-based expression systems?

Engineering recombinant YidC for enhanced protein secretion or membrane insertion requires strategic modifications based on structure-function relationships:

Signal Peptide Optimization:
Recent advances in Mycoplasma pneumoniae have demonstrated that the secretion signals from MPN142 protein can be improved through targeted modifications. Specifically:

  • Mutations at the P1' position of the signal peptide cleavage site modulate but do not eliminate secretion efficiency

  • Increasing hydrophobicity at the C-terminal region of signal peptides significantly enhances secretion

  • Different lipoprotein signal peptides exhibit variable retention and secretion rates, with some sequences functioning as full secretion motifs rather than anchoring motifs

These findings challenge traditional assumptions about lipobox motifs in membrane protein anchoring and provide a foundation for rational engineering of YidC to optimize its membrane insertion function.

Structural Engineering Approach:
Based on structural models derived from evolutionary co-variation analysis, researchers can target specific residues in YidC that:

  • Modulate substrate binding affinity through alterations in the hydrophobic core

  • Enhance ribosome interaction by optimizing charged residues at the cytoplasmic interface

  • Improve release kinetics by modifying the proposed lateral gate for membrane insertion

A combinatorial approach testing these modifications in the context of different substrate proteins would yield valuable insights into optimizing YidC function for biotechnological applications.

What role might YidC play in host-pathogen interactions during Mycoplasma pulmonis infection?

YidC likely plays multiple critical roles in host-pathogen interactions during M. pulmonis infection:

Virulence Factor Expression:
As a membrane protein insertase, YidC facilitates the proper localization of surface antigens and virulence factors. Studies on M. pulmonis membranes have identified seven major surface-exposed polypeptides that represent the predominant antigens recognized by the host during natural infection . YidC is likely essential for the proper membrane integration of these immunogenic proteins.

Adaptation to Host Environment:
M. pulmonis causes chronic pulmonary disease, with symptoms including red oculonasal discharge, nasal stridor, sneezing, and in severe cases, weight loss and respiratory distress . The progression from subclinical to active infection often depends on environmental factors or co-infection. YidC may participate in the adaptive response by facilitating changes in membrane protein composition under stress conditions.

Immune Evasion:
The pleomorphic nature of mycoplasmas, enabled in part by their dynamic membrane composition, contributes to immune evasion. YidC-mediated membrane protein insertion likely facilitates rapid membrane remodeling in response to host immune pressures.

Therapeutic Target Potential:
Understanding YidC's role in virulence factor expression could lead to novel therapeutic approaches that disrupt pathogen membrane biogenesis rather than targeting conventional pathways already exploited by current antimicrobials.

How do molecular dynamics simulations enhance our understanding of YidC function in Mycoplasma species?

Molecular dynamics (MD) simulations provide crucial insights into YidC function at the atomic level:

Membrane Interaction Dynamics:
MD simulations of YidC reveal that while the five transmembrane helices form a rigid protein core, the polar loop regions "swim" on the membrane surface, suggesting dynamic interactions with membrane lipids . This behavior likely influences substrate recognition and insertion.

Stabilizing Interactions:
Simulations identify key residue interactions that stabilize the protein structure:

  • Hydrophobic residues on the exterior stabilize interactions with apolar lipid tails

  • Polar/charged residues toward the cytoplasmic side engage in electrostatic interactions

  • Aromatic residues on the periplasmic side participate in stacking and nonpolar dispersion interactions

Functional Validation:
The functional importance of residues identified in MD simulations can be experimentally verified. For example, alanine mutations of stabilizing residues T362 in TM2 and Y517 in TM6 completely inactivated YidC in complementation assays despite stable protein expression .

Simulation Parameters for Mycoplasma YidC Studies:

ParameterRecommended SettingJustification
Force FieldCHARMM36Optimized for membrane proteins and lipids
Water ModelTIP3PCompatible with CHARMM force fields
Membrane Composition3:1 POPE:POPGSuccessfully used for bacterial membrane simulations
Simulation LengthMinimum 100 nsRequired for observing conformational changes
Analysis FocusInter-residue interactions, water accessibility, lipid interactionsKey determinants of insertion function

What are the common pitfalls in purifying functionally active recombinant YidC from Mycoplasma pulmonis?

Purification of functionally active YidC presents several challenges:

Membrane Protein Solubilization:
YidC, with its five transmembrane helices, requires careful detergent selection to maintain native conformation. Non-ionic detergents like DDM (n-dodecyl β-D-maltoside) often preserve functionality, but optimization is necessary for each specific protein.

Lipid Environment Preservation:
YidC function depends critically on specific interactions with membrane lipids. Studies using MD simulations have shown that hydrophobic residues on the exterior of the TM bundle stabilize interactions with apolar lipid tails . During purification, maintaining a native-like lipid environment through addition of lipid extracts or reconstitution into nanodiscs can help preserve activity.

Avoiding Aggregation:
The hydrophobic nature of YidC makes it prone to aggregation during concentration steps. Strategies to minimize aggregation include:

  • Using stabilizing additives like glycerol or specific lipids

  • Maintaining dilute protein concentrations

  • Employing size exclusion chromatography as a final purification step

  • Considering fusion tags that enhance solubility

Activity Verification:
Unlike soluble enzymes, assessing membrane insertase activity is challenging and requires specialized assays such as:

  • Proteoliposome reconstitution followed by substrate insertion assays

  • In vitro translation-insertion systems using fluorescently labeled substrate proteins

  • Complementation assays in YidC-depleted bacterial strains

How can researchers differentiate between effects of YidC mutations on protein stability versus functional activity?

Distinguishing stability effects from functional defects requires a systematic approach:

Quantitative Expression Analysis:

  • Western blotting with calibrated standards to quantify protein levels

  • Pulse-chase experiments to assess protein turnover rates

  • RT-qPCR to ensure equivalent transcription of wild-type and mutant constructs

Structural Integrity Assessment:

  • Limited proteolysis to detect conformational changes

  • Circular dichroism to evaluate secondary structure content

  • Thermal shift assays to measure protein stability

Membrane Localization:

  • Subcellular fractionation to confirm proper membrane association

  • Protease accessibility assays to verify correct topology

  • Fluorescence microscopy with tagged constructs to visualize localization patterns

Functional Separation:

  • In vitro binding assays to separate substrate recognition from insertion activity

  • Ribosome interaction assays to evaluate co-translational functions

  • Step-wise analysis of the insertion process using arrested translocation intermediates

Correlation Analysis:
Create a scatter plot relating stability measurements to functional activity across multiple mutants. Outliers with high stability but low function represent true functional defects rather than stability issues. This approach has successfully identified critical functional residues in YidC homologs .

What strategies can optimize PCR-based detection and quantification of the yidC gene in Mycoplasma pulmonis samples?

Optimizing PCR-based detection of the yidC gene requires addressing several technical considerations:

Primer Design Optimization:
Building on successful approaches for M. hominis yidC detection , researchers should:

  • Target highly conserved regions within the yidC gene

  • Perform multiple sequence alignments of yidC across Mycoplasma species to identify optimal target regions

  • Design primers with similar melting temperatures and minimal secondary structure

  • Avoid regions with significant intraspecies heterogeneity

Assay Development Parameters:

ParameterRecommendationRationale
PCR FormatTaqMan quantitative real-time PCRProvides specificity through probe hybridization and enables quantification
Detection LimitAim for 5-10 copies/μLSimilar sensitivity to that achieved for M. hominis yidC (7 copies/μL)
ControlsInclude positive, negative, and inhibition controlsEssential for reliable clinical or research applications
ValidationTest against culture quantificationCorrelation between PCR and culture quantification validates assay reliability

Sample Processing:

  • Optimize DNA extraction from different sample types to maximize yield and purity

  • Evaluate and mitigate potential PCR inhibitors in complex biological samples

  • Consider pre-enrichment steps for low-abundance samples

Applications Beyond Detection:

  • Use quantitative PCR for measuring gene expression levels during different growth phases

  • Develop multiplex assays to simultaneously detect multiple Mycoplasma species

  • Implement digital PCR for absolute quantification without standard curves

This optimized approach should yield a specific, sensitive, and reproducible real-time PCR method for detecting and quantifying M. pulmonis yidC, similar to the successful development for M. hominis .

How might comparative studies between YidC homologs from different Mycoplasma species advance our understanding of membrane protein biogenesis?

Comparative studies of YidC across Mycoplasma species offer a unique opportunity to explore evolutionary adaptation in membrane protein biogenesis. With their minimalist genomes resulting from reductive evolution, mycoplasmas provide an excellent model for understanding the core essential functions of YidC.

Research approaches should include:

  • Systematic sequence analysis across diverse Mycoplasma species to identify conserved motifs versus species-specific variations

  • Cross-species complementation assays to determine functional conservation

  • Structural modeling based on covariation analysis to relate sequence differences to structural adaptations

  • Characterization of substrate specificity differences that might reflect host adaptation

  • Investigation of YidC's co-evolutionary relationships with other membrane biogenesis factors

Such comparative studies would reveal how YidC has adapted to different membrane compositions, physiological constraints, and host environments while maintaining its essential function in membrane protein insertion.

What potential exists for developing YidC-targeted antimicrobial strategies against Mycoplasma infections?

The essential role of YidC in membrane protein biogenesis makes it an attractive target for novel antimicrobial strategies against Mycoplasma infections, which are often challenging to treat due to their lack of cell wall and consequent resistance to many conventional antibiotics.

Target Validation:

  • YidC's conservation across Mycoplasma species suggests broad-spectrum potential

  • Its absence in mammalian cells reduces toxicity concerns

  • The essential nature of membrane protein insertion provides a strong selective pressure against resistance development

Therapeutic Approaches:

  • Small molecule inhibitors targeting conserved functional sites identified through structural studies and MD simulations

  • Peptide-based inhibitors designed to compete with substrate binding

  • RNA-based strategies to downregulate YidC expression

  • CRISPR-Cas delivery systems targeting the yidC gene

Delivery Challenges:
For respiratory infections like those caused by M. pulmonis , localized delivery to the lung might be achieved through:

  • Inhalable formulations of YidC inhibitors

  • Engineered Mycochassis (non-pathogenic M. pneumoniae chassis) delivering anti-YidC compounds

  • Nanoparticle-based delivery systems with tropism for respiratory epithelia

The development of YidC-targeted antimicrobials would represent a novel approach to addressing the increasing concern of antibiotic resistance in mycoplasma infections.

How could structural insights from YidC be applied to optimize the Mycochassis platform for therapeutic protein delivery?

The engineered Mycoplasma pneumoniae chassis (Mycochassis) represents a promising platform for delivering therapeutic molecules to the respiratory tract . Structural and functional insights from YidC research could significantly enhance this platform:

Optimized Secretion Systems:

  • Leveraging discoveries about signal peptide modifications that increase secretion efficiency

  • Engineering YidC variants with enhanced insertion capacity for therapeutic membrane proteins

  • Developing controllable secretion switches based on YidC-dependent pathways

Membrane Display Applications:
Research has shown that lipoprotein signal peptides exhibit variable retention and secretion rates . This knowledge could be applied to:

  • Create tunable surface display systems for antigens or therapeutic proteins

  • Develop multi-valent vaccine delivery platforms

  • Engineer membrane-anchored enzymes for localized therapeutic activity

Mycochassis Enhancements:
The non-pathogenic Mycochassis can survive more than 4 days in the murine lung and causes minimal inflammatory response . YidC engineering could further improve:

  • Chassis stability through optimized membrane composition

  • Controlled protein secretion kinetics for sustained therapeutic delivery

  • Enhanced tropism for specific cell types through surface protein display

Therapeutic Applications:
Building on successful expression of complex molecules like human IL-10 and biofilm-degrading enzymes , YidC optimization could enable:

  • Multi-component protein complexes for advanced therapies

  • Membrane-bound immune modulators for targeted immunotherapy

  • Engineered extracellular vesicles containing therapeutic cargo

These applications would leverage the natural tropism of Mycoplasma for the human respiratory tract and its enrichment in solid lung tumors , offering targeted delivery with high bioavailability and reduced systemic effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.