Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE)

What is the basic structure of Mycoplasma synoviae ATP synthase subunit c (atpE)?

The Mycoplasma synoviae ATP synthase subunit c (atpE) is a relatively small protein consisting of 111 amino acids with the sequence: MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK. It functions as part of the F₀ component of the F₀F₁-ATP synthase complex. The protein contains hydrophobic regions that anchor it in the membrane, forming part of the c-ring structure that rotates during ATP synthesis. The protein has several synonyms in the literature, including ATP synthase F(0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, and Lipid-binding protein . In structural studies, atpE is known to form oligomeric rings (c-rings) that are crucial for proton translocation and subsequent ATP synthesis.

What post-translational modifications are typically observed in native Mycoplasma synoviae atpE?

Native Mycoplasma synoviae atpE undergoes minimal post-translational modifications compared to eukaryotic ATP synthase components. The protein primarily functions through its conserved acidic residues, particularly glutamic acid, which are crucial for proton binding and translocation. While recombinant expressions typically include artificial modifications such as His-tagging for purification purposes , the native protein generally lacks extensive post-translational modifications. This simplicity makes it an attractive model for studying fundamental aspects of rotary molecular motors and energy coupling mechanisms. Researchers investigating post-translational modifications should focus on potential lipid interactions since the protein functions as a lipid-binding component within the membrane environment.

What are the optimal conditions for expressing recombinant Mycoplasma synoviae atpE in E. coli?

For successful expression of recombinant Mycoplasma synoviae atpE in E. coli, researchers must address the genetic code difference in which UGA codons encode tryptophan in Mycoplasma but serve as stop codons in E. coli. Site-directed mutagenesis must be performed to convert all UGA codons to TGG to enable proper translation in E. coli . The optimized protocol involves PCR amplification of genomic DNA, followed by overlap-extension PCR for site-directed mutagenesis. The mutated gene can then be cloned into an expression vector such as pET-28a(+) and transformed into E. coli BL21(DE3) cells . Expression is typically induced with IPTG at optimal concentrations of 0.5-1.0 mM when cultures reach OD₆₀₀ of 0.6-0.8, followed by incubation at 16-25°C for 16-18 hours to minimize inclusion body formation and maximize soluble protein yield.

What purification strategy provides the highest yield and purity for recombinant atpE protein?

The most effective purification strategy for His-tagged recombinant Mycoplasma synoviae atpE involves a multi-step approach:

• Initial capture using Ni-NTA affinity chromatography with imidazole gradients (20-250 mM)

• Buffer exchange to remove imidazole

• Ion-exchange chromatography to separate based on charge properties

• Size-exclusion chromatography as a polishing step

How can researchers overcome expression challenges related to the unique codon usage in Mycoplasma synoviae?

Addressing the unique codon usage in Mycoplasma synoviae requires a strategic approach beyond simple cloning. The primary challenge is the UGA codon, which encodes tryptophan in Mycoplasma but serves as a termination signal in E. coli. To overcome this, researchers should:

• Identify all UGA codons in the atpE gene through sequence analysis

• Design primers for site-directed mutagenesis to convert UGA to TGG codons

• Implement overlap-extension PCR with multiple primer pairs to systematically mutate each UGA codon

• Verify complete mutation through sequencing before expression

Alternatively, specialized E. coli strains with suppressor tRNAs can be employed, though these often yield lower expression levels. Another approach is to use codon-optimized synthetic genes that account for both the UGA codons and optimize all codons according to E. coli preference. For difficult expression cases, cell-free protein synthesis systems with customized tRNA pools represent an advanced solution that bypasses cellular translational constraints.

What is the role of conserved glutamic acid residues in Mycoplasma synoviae atpE function?

Conserved glutamic acid residues in the Mycoplasma synoviae atpE play a critical role in proton translocation and energy coupling. These residues, particularly those positioned within the transmembrane domains, undergo protonation and deprotonation cycles essential for c-ring rotation. During ATP synthesis, protons from the periplasmic space protonate these glutamic acid residues, causing conformational changes that facilitate rotation of the c-ring relative to the a-subunit . Studies on similar ATP synthases demonstrate that mutations of these conserved glutamic acids (such as E56D mutations) significantly reduce ATP synthesis activity, highlighting their essential role in the proton transfer pathway . The precise positioning of these residues creates a proton wire through the membrane, allowing vectorial proton transport coupled to mechanical rotation, which ultimately drives ATP synthesis at the catalytic sites of the F₁ sector.

How does the c-subunit oligomeric ring structure contribute to ATP synthesis?

The c-subunit oligomeric ring structure forms a critical rotor component within the F₀ sector of ATP synthase, serving as the mechanical transducer that converts proton gradient energy into rotational motion. In the functional complex:

• Multiple c-subunits assemble into a ring formation embedded in the membrane

• Each c-subunit contains essential glutamic acid residues that bind and release protons

• The interface between the c-ring and a-subunit forms the proton translocation pathway

• Proton movement through this interface drives incremental rotation of the c-ring

This rotation is mechanically coupled to the central stalk of the F₁ sector, inducing conformational changes in the catalytic sites that synthesize ATP . Importantly, research demonstrates that neighboring c-subunits cooperate during this process—mutations in multiple c-subunits reduce activity more significantly than expected from additive effects, particularly when the mutations are spaced further apart around the ring . This cooperation suggests that multiple c-subunits simultaneously participate in the proton transfer events that drive rotation.

What experimental evidence demonstrates cooperation among c-subunits in ATP synthase function?

Compelling experimental evidence for cooperation among c-subunits comes from studies using genetically fused single-chain c-rings with site-specific mutations. Research on Bacillus PS3 ATP synthase with various combinations of wild-type and mutant (E56D) c-subunits revealed:

• A single E56D mutation reduced ATP synthesis and proton pump activities, but did not completely inhibit function

• Double E56D mutations caused further decreased activity

• Most significantly, activity progressively decreased as the distance between two mutation sites increased around the c-ring

This positional dependence of mutation effects could only be explained by functional coupling between c-subunits. Supporting molecular dynamics simulations showed that prolonged proton uptake times in mutated c-subunits could be shared between two subunits, with the degree of time-sharing decreasing as the distance between mutation sites increased . This research conclusively demonstrates that at least three c-subunits at the a/c interface cooperate during c-ring rotation, contradicting models where each c-subunit operates independently.

What are the most effective methods for studying atpE protein-protein interactions within the ATP synthase complex?

For investigating atpE protein-protein interactions within the ATP synthase complex, researchers should employ a multi-method approach:

• Cross-linking studies: Using chemical cross-linkers with defined spacer lengths to identify proximal subunits, followed by mass spectrometry analysis to identify interaction sites.

• FRET (Förster Resonance Energy Transfer): By labeling atpE and potential interacting partners with appropriate fluorophore pairs, researchers can detect interactions through energy transfer measurements.

• Co-immunoprecipitation: Using antibodies against atpE to pull down the protein along with its interacting partners, followed by identification via western blotting or mass spectrometry.

• Bacterial two-hybrid systems: Particularly useful for studying membrane protein interactions in a cellular context while avoiding issues with nuclear localization required in yeast two-hybrid systems.

• Nanodiscs and liposome reconstitution: Reconstituting purified components into lipid nanodiscs or liposomes allows functional studies of interactions in a membrane environment that closely mimics native conditions.

These methods can be complemented with structural approaches such as cryo-electron microscopy to visualize the entire complex architecture and pinpoint specific interaction interfaces between atpE and other ATP synthase components.

How can researchers effectively design experiments to study the effects of mutations in Mycoplasma synoviae atpE?

Designing effective mutation studies for Mycoplasma synoviae atpE requires a systematic approach:

• Mutation selection strategy:

  • Target conserved residues identified through multiple sequence alignment

  • Focus on glutamic acid residues involved in proton binding

  • Create a series of mutations with varying degrees of chemical change (conservative to radical)

• Expression system optimization:

  • Use genetic fusion constructs to create single-chain c-rings with precise mutation positioning

  • Ensure complete mutation of UGA codons to TGG for E. coli expression

• Functional assays:

  • ATP synthesis measurements using reconstituted proteoliposomes

  • Proton pumping assays with pH-sensitive fluorescent dyes

  • ATPase activity measurements in both detergent-solubilized and reconstituted systems

• Data analysis approach:

  • Compare effects of single vs. multiple mutations

  • Analyze positional effects by varying distances between multiple mutations

  • Correlate biochemical data with computational predictions from molecular dynamics simulations

This comprehensive approach enables researchers to distinguish between local effects on individual c-subunits and cooperative effects involving multiple subunits in the functional complex.

What reconstitution systems are most appropriate for functional studies of recombinant atpE?

For functional studies of recombinant Mycoplasma synoviae atpE, several reconstitution systems offer distinct advantages:

• Proteoliposomes:

  • Composition: Typically 75% phosphatidylcholine and 25% phosphatidic acid

  • Advantages: Creates proton-impermeable vesicles capable of generating/maintaining proton gradients

  • Applications: Ideal for ATP synthesis/hydrolysis coupled to proton translocation

• Nanodiscs:

  • Composition: Phospholipid bilayers encircled by membrane scaffold proteins

  • Advantages: Provides a defined, monodisperse membrane environment with both sides accessible

  • Applications: Excellent for binding studies and single-molecule measurements

• Hybrid systems:

  • Combining recombinant atpE with native ATP synthase components from which atpE has been depleted

  • Advantages: Allows study of atpE variants in the context of otherwise native complexes

  • Applications: Particularly useful for understanding species-specific aspects of atpE function

The choice of reconstitution system should be guided by the specific research question, with proteoliposomes being preferred for functional assays of proton translocation and ATP synthesis, while nanodiscs may be superior for detailed biochemical and structural studies of the isolated subunit.

How do mutations in atpE affect the energetic efficiency of ATP synthesis in Mycoplasma synoviae?

The energetic efficiency of ATP synthesis in Mycoplasma synoviae is intimately linked to the structure and function of atpE subunits in the c-ring. Mutations in atpE can alter this efficiency through multiple mechanisms:

What role might atpE play in the pathogenicity of Mycoplasma synoviae infections?

While direct evidence for atpE's role in Mycoplasma synoviae pathogenicity is limited, several mechanisms can be proposed based on current understanding of ATP synthase function in bacterial pathogenesis:

• Energy production for virulence: As a critical component of ATP synthesis, atpE indirectly supports all energy-dependent virulence mechanisms. Mycoplasma synoviae requires substantial energy for colonization, adhesion, and immune evasion.

• Adaptation to host environments: The ATP synthase complex may be specifically adapted to function optimally in the microenvironments encountered during infection, such as the respiratory tract or joint spaces.

• Potential immunomodulatory effects: Some bacterial ATP synthase components have been shown to interact with host immune factors. Surface exposure of atpE or its fragments could potentially trigger or modulate host immune responses.

• Target for host defense mechanisms: Host factors may target ATP synthase to disrupt bacterial energy metabolism, requiring Mycoplasma synoviae to evolve protective mechanisms around these essential components.

Future research should investigate potential interactions between atpE and host factors, examine expression changes during infection, and consider atpE as a potential diagnostic marker given its essential and conserved nature.

How might the understanding of atpE function contribute to the development of antimicrobial strategies against Mycoplasma synoviae?

The essential nature of atpE in energy metabolism positions it as a promising target for antimicrobial development against Mycoplasma synoviae:

• Specific inhibitor development:

  • Targeting unique structural features of Mycoplasma synoviae atpE not present in host ATP synthases

  • Focusing on the proton binding sites and their unique arrangement in the c-ring

  • Designing peptidomimetics that disrupt c-ring assembly or interaction with other subunits

• Combination therapy approaches:

  • Using ATP synthase inhibitors to sensitize Mycoplasma to other antibiotics

  • Targeting multiple components of energy metabolism simultaneously

  • Developing dual-action molecules that bind both atpE and other targets

• Vaccination strategies:

  • Investigating atpE-derived peptides as potential vaccine components

  • Examining surface-exposed regions of the protein for immunogenicity

  • Developing attenuated strains with modified but functional atpE

• Diagnostic applications:

  • Using atpE-specific antibodies for improved detection of Mycoplasma synoviae infection

  • Developing PCR-based detection methods targeting unique sequences in the atpE gene

  • Creating biosensors that detect atpE or its fragments in clinical samples

This multi-faceted approach could address the growing concern of antimicrobial resistance in Mycoplasma infections, particularly in poultry where M. synoviae infections cause significant economic losses.

How does the structure and function of atpE compare across different Mycoplasma species?

Comparative analysis of atpE across Mycoplasma species reveals both conserved features essential for ATP synthase function and species-specific adaptations. The core structure—a small hydrophobic protein with critical glutamic acid residues for proton binding—remains conserved, but several notable variations exist:

• Sequence conservation pattern:

  • The transmembrane regions containing proton-binding sites show highest conservation

  • Terminal regions display greater sequence diversity

  • Key glutamic acid residues (equivalent to E56 in many species) are nearly universally conserved

• Size variations:

  • Mycoplasma synoviae atpE consists of 111 amino acids

  • Other Mycoplasma species show size variations ranging from 100-120 amino acids

  • These differences primarily occur in loop regions without compromising core function

• c-ring stoichiometry:

  • The number of c-subunits forming the complete ring varies across species

  • This variation affects the proton-to-ATP ratio and thus the bioenergetic efficiency

  • Evolutionary adaptations may optimize this ratio for specific host environments

These comparative analyses provide insights into the minimum structural requirements for ATP synthase function while highlighting potential adaptations to specific ecological niches occupied by different Mycoplasma species.

What experimental approaches can determine the number of c-subunits in the native Mycoplasma synoviae ATP synthase complex?

Determining the exact number of c-subunits in the native Mycoplasma synoviae ATP synthase complex requires specialized experimental approaches:

• Electron microscopy techniques:

  • Cryo-electron microscopy of purified complexes to visualize c-ring symmetry

  • Negative staining EM followed by rotational averaging to enhance structural features

  • Single-particle analysis to determine symmetry from multiple particle images

• Mass spectrometry approaches:

  • Native mass spectrometry of intact c-rings to determine total molecular weight

  • Crosslinking followed by MS analysis to confirm adjacent subunit interactions

  • Isotope-labeled reconstitution to verify stoichiometric assembly

• Functional measurements:

  • Determination of H⁺/ATP ratio through simultaneous measurement of proton translocation and ATP synthesis

  • This ratio directly correlates with c-ring stoichiometry

• Genetic approaches:

  • Generation of fused c-subunit constructs with defined numbers of copies

  • Complementation studies with these constructs in atpE-deleted strains to determine minimal functional unit

These methods can be combined to provide converging evidence for the native c-ring stoichiometry, which is critical for understanding the bioenergetic properties of Mycoplasma synoviae ATP synthase.

How can researchers address solubility issues when working with recombinant atpE protein?

Addressing solubility challenges with recombinant Mycoplasma synoviae atpE requires a systematic approach tailored to this highly hydrophobic membrane protein:

• Expression optimization strategies:

  • Reduced induction temperature (16-20°C) to slow protein synthesis

  • Lower IPTG concentrations (0.1-0.5 mM) to reduce expression rate

  • Specialized E. coli strains (C41/C43) designed for membrane protein expression

• Fusion tag selection:

  • N-terminal His-tag is standard but may affect solubility

  • Consider larger solubility-enhancing tags (MBP, SUMO, or TrxA)

  • C-terminal tags may be preferable depending on membrane topology

• Detergent screening matrix:

• Reconstitution approaches:

  • Direct extraction into nanodiscs or amphipols

  • Co-expression with membrane scaffold proteins

  • Cell-free expression systems with supplied lipids/detergents

For particularly challenging preparations, consider stepwise solubilization protocols, beginning with milder detergents before proceeding to more stringent conditions, or explore lipid-based extraction methods that better mimic the native membrane environment.

What are the key considerations for developing specific antibodies against Mycoplasma synoviae atpE?

Developing specific antibodies against Mycoplasma synoviae atpE presents unique challenges due to its hydrophobic nature and membrane localization. Researchers should consider:

• Antigen design strategies:

  • Focus on hydrophilic regions for peptide-based approaches

  • Use recombinant protein in detergent micelles for whole-protein immunization

  • Consider multiple peptides from different regions to maximize coverage

• Host selection considerations:

  • Rabbits provide good yield and affinity for polyclonal approaches

  • Mice are preferred for monoclonal antibody development

  • Consider phylogenetic distance between host and Mycoplasma to maximize immunogenicity

• Validation protocol requirements:

  • Western blot against both recombinant and native protein

  • Immunofluorescence to verify cellular localization

  • Pre-adsorption controls to confirm specificity

  • Cross-reactivity testing against related Mycoplasma species

• Application-specific optimizations:

  • For structural studies: epitopes outside functional domains

  • For functional inhibition: target proton-binding regions

  • For detection assays: accessible epitopes in native conformation

The most successful approach often combines both peptide antibodies targeting specific epitopes and whole-protein antibodies recognizing conformational determinants, providing complementary tools for different experimental applications.

What emerging technologies might advance our understanding of atpE function in Mycoplasma synoviae?

Several cutting-edge technologies hold promise for deepening our understanding of atpE function in Mycoplasma synoviae:

• Single-molecule techniques:

  • High-speed atomic force microscopy to visualize c-ring rotation in real-time

  • Single-molecule FRET to track conformational changes during proton translocation

  • Magnetic tweezers to measure torque generation by the c-ring

• Advanced structural methods:

  • Cryo-electron tomography of intact bacterial cells to visualize ATP synthase in native membranes

  • Microcrystal electron diffraction for high-resolution structural details of membrane-embedded regions

  • Integrative structural biology combining multiple data sources (EM, crosslinking, molecular dynamics)

• Synthetic biology approaches:

  • Minimal synthetic cells incorporating engineered ATP synthase components

  • Orthogonal translation systems for site-specific incorporation of probes or crosslinkers

  • In vitro reconstitution of defined hybrid ATP synthase complexes

• Computational advances:

  • Quantum mechanics/molecular mechanics simulations of proton transfer events

  • Machine learning approaches to predict functional impacts of mutations

  • Systems biology models integrating ATP synthase function with cellular energetics

These technologies promise to bridge existing knowledge gaps, particularly regarding the dynamic aspects of atpE function and its integration into cellular energy metabolism.

How might systems biology approaches contribute to understanding atpE in the context of Mycoplasma synoviae metabolism?

Systems biology approaches offer powerful frameworks for contextualizing atpE function within the broader metabolic network of Mycoplasma synoviae:

• Genome-scale metabolic modeling:

  • Integration of ATP synthase activity parameters into constraint-based models

  • Flux balance analysis to predict metabolic adaptations to ATP synthase perturbations

  • Identification of synthetic lethal interactions with other energy-generating pathways

• Multi-omics integration:

  • Correlation of atpE expression with transcriptome, proteome, and metabolome data

  • Identification of regulatory networks governing ATP synthase expression

  • Characterization of metabolic shifts under varying energy demands

• Host-pathogen interaction modeling:

  • Simulation of energetic requirements during different infection stages

  • Prediction of metabolic vulnerabilities during host adaptation

  • Integration of host defense mechanisms targeting bacterial energy metabolism

• Network-based drug target identification:

  • Identification of system-level vulnerabilities involving ATP synthase

  • Prediction of combination therapies targeting multiple nodes in energy metabolism

  • Assessment of potential resistance mechanisms through network rewiring

These approaches would complement traditional reductionist studies by providing a holistic view of atpE's role in cellular energetics and revealing emergent properties not apparent from isolated component analysis.