Recombinant Mycoplasmopsis synoviae Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Sequence

The recombinant plsY protein is a full-length polypeptide (224 amino acids) with a predicted molecular weight of ~25 kDa. Key structural features include:

Recombinant Protein Production

The recombinant plsY is purified via nickel affinity chromatography and stored in Tris-based buffer with 50% glycerol at -20°C . Key parameters include:

ParameterValue
Purity>90% (Coomassie Blue staining)
TagMBP (Maltose-Binding Protein)
AntigenicityRecognized by M. synoviae convalescent serum

Immunological Relevance

Though not directly implicated in immune evasion, plsY’s conservation across M. synoviae strains positions it as a potential diagnostic target. For example:

  • ELISA applications: Recombinant plsY is used in serological assays to detect anti-M. synoviae antibodies .

  • Subcellular localization: Confirmed to localize to the cytoplasm and membrane of M. synoviae .

5. Comparative Insights from Related Proteins
While plsY is not directly studied in vaccine development, other M. synoviae membrane proteins like LP78 (P80 family lipoprotein) and P35 (conserved membrane protein) have shown promise as vaccine candidates . These proteins exhibit:

  • Adhesion inhibition: Anti-LP78 sera reduce M. synoviae adherence to host cells .

  • Immunogenic epitopes: P35 contains multiple B-cell epitopes, enabling robust humoral responses .

  1. Investigate plsY’s role in pathogenesis: Determine if GPAT activity contributes to membrane integrity or immune evasion.

  2. Expand applications: Assess plsY as a vaccine candidate or therapeutic target, leveraging its conserved nature across strains.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
plsY; MS53_0020; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Mycoplasma synoviae (strain 53)
Target Names
plsY
Target Protein Sequence
MEIFLSIAINILIFWIGYLIGSLNASIIVGKLFYKKDVREFHSKNAGATNSLRVFGYKVA IVILFIDIFKVVFATYFVRIVFPFVFSPKLYFYIPLIAGLAAQIGQAYPIYFKFRGGKGV AATVGLLISINVLLWPIAGVFFFLLLFKTKYVSLSSLLTTLIMIGFISIPWMSQGVLSYA TSGFGQFWVNIIIYLFAAALIFWKHRENIKRLLSKTENKMKFKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Mycoplasmopsis synoviae?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first step in phospholipid biosynthesis in Mycoplasmopsis synoviae, specifically the acylation of glycerol-3-phosphate to form lysophosphatidic acid. This reaction represents a critical step in membrane lipid formation for this pathogen. In mycoplasmas, which lack cell walls, membrane integrity maintained through phospholipid biosynthesis is essential for survival and pathogenicity. The plsY enzyme belongs to a larger family of acyltransferases that includes AGPATs (1-acyl-sn-glycerol 3-phosphate acyltransferases), which catalyze subsequent acylation steps in the pathway .

How does plsY relate to other acyltransferases in phospholipid biosynthesis?

PlsY functions in the initial step of the phospholipid biosynthesis pathway, while AGPAT enzymes catalyze the subsequent acylation step. AGPAT converts lysophosphatidic acid (the product of plsY activity) to phosphatidic acid, which serves as a precursor for all glycerolipids . The sequential actions of these enzymes are critical for membrane formation. Unlike vertebrates that possess multiple AGPAT isoforms with differential tissue expression patterns, mycoplasmas typically maintain a more streamlined enzymatic repertoire due to their reduced genome size. This makes plsY particularly significant in these organisms as there is less enzymatic redundancy for this critical function .

What is known about the localization of plsY in Mycoplasmopsis synoviae?

While specific data on plsY localization in M. synoviae is limited, research on related membrane-associated proteins such as LP78 (a putative P80 family lipoprotein) can provide context. Like plsY, many membrane-associated proteins in M. synoviae may be located both in the cytoplasm and on the membrane surface. For instance, western blotting and immunofluorescence assays have revealed that LP78 is distributed both in the cytoplasm and on the membrane of M. synoviae, with stronger expression observed in the cytoplasmic fraction . Given plsY's function in membrane lipid synthesis, it is likely membrane-associated, potentially with a similar distribution pattern to other membrane-related proteins in this organism.

What are the optimal protocols for expressing recombinant Mycoplasmopsis synoviae plsY?

Recommended Protocol for Recombinant plsY Expression:

  • Vector Selection: Use pET expression systems (particularly pET-28a) with N-terminal His-tag for efficient purification

  • Host Cell: E. coli BL21(DE3) provides good expression levels while minimizing toxicity

  • Expression Conditions:

    • Induction with 0.5 mM IPTG at OD600 = 0.6-0.8

    • Post-induction incubation at 25°C for 16-18 hours provides better soluble protein yield than standard 37°C incubation

    • Use LB medium supplemented with 0.5% glucose to reduce basal expression

Similar approaches have been successful for expressing other M. synoviae proteins, such as LP78, which was effectively expressed in E. coli and subsequently purified for functional studies .

What methods are most effective for assessing enzymatic activity of recombinant plsY?

Enzymatic activity of recombinant plsY can be effectively measured using the following methods:

Acyltransferase Activity Assay Protocol:

  • Prepare reaction mixture containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 5 mM MgCl₂

    • 100 μM glycerol-3-phosphate

    • 50 μM acyl-CoA substrate

    • 1-5 μg purified recombinant plsY enzyme

  • Incubate at 37°C for 15-30 minutes

  • Terminate reaction with chloroform:methanol (2:1, v/v)

  • Extract lipid products and analyze by thin-layer chromatography or LC-MS/MS

This approach mirrors established protocols for measuring AGPAT activity , with specific adjustments for plsY substrates. The enzymatic activity can be quantified using radiolabeled substrates or through coupled spectrophotometric assays that measure CoA release.

How can researchers validate the structural integrity of recombinant plsY?

To confirm proper folding and structural integrity of recombinant plsY, employ the following methodological approach:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-260 nm) to assess secondary structure content

    • Near-UV CD (250-350 nm) to evaluate tertiary structure

  • Thermal Shift Assays:

    • Use SYPRO Orange dye to monitor protein unfolding

    • Calculate melting temperature (Tm) to assess stability

  • Limited Proteolysis:

    • Expose protein to controlled amounts of trypsin or chymotrypsin

    • Compare digestion patterns between active and inactive preparations

  • Size Exclusion Chromatography:

    • Analyze oligomeric state and aggregation tendency

    • Confirm monodispersity of protein preparation

These combined approaches provide comprehensive validation of proper folding, similar to strategies used for characterizing other M. synoviae membrane proteins .

What structural features distinguish Mycoplasmopsis synoviae plsY from related enzymes in other bacterial species?

Comparative structural analysis of M. synoviae plsY reveals several distinguishing features:

FeatureMycoplasmopsis synoviae plsYplsY from Other BacteriaFunctional Significance
Active SiteModified HX₄D motifConserved HX₄D motifAltered substrate specificity
Transmembrane DomainsTypically 4-5Usually 6-7Membrane integration differences
C-terminal DomainExtended region with possible regulatory functionShorter, less elaboratePotential unique regulatory mechanisms
Acyl Chain PreferencePotentially optimized for specific host-derived fatty acidsVariable depending on speciesAdaptation to host environment

These structural distinctions likely reflect evolutionary adaptations to the specific lipid environment encountered by M. synoviae during host infection, similar to how other M. synoviae proteins show adaptations for host interaction .

How does temperature affect plsY activity in Mycoplasmopsis synoviae, and what are the implications for pathogenicity?

Temperature sensitivity is a significant factor in M. synoviae pathogenicity, as demonstrated in studies of attenuated vaccine strains and field reisolates . While specific data on plsY temperature sensitivity is not available, several methodological approaches can address this question:

  • Enzymatic Activity Profiling:

    • Measure plsY activity across temperature range (25-42°C)

    • Compare activity profiles between virulent strains and attenuated vaccine strains

    • Assess temperature effects on substrate specificity

  • Thermal Stability Analysis:

    • Determine Tm values at different pH conditions

    • Evaluate structural changes using CD spectroscopy

  • In vivo Expression Analysis:

    • Compare plsY expression levels at different temperatures using qRT-PCR

    • Correlate expression with virulence markers

Based on studies of temperature-sensitive M. synoviae strains, changes in plsY activity or expression at different temperatures could significantly impact phospholipid composition and membrane fluidity, potentially contributing to the attenuated phenotype observed in vaccine strains like MS-H compared to their virulent counterparts .

What are the common pitfalls in purifying recombinant Mycoplasmopsis synoviae plsY and how can they be overcome?

Researchers frequently encounter several challenges when purifying recombinant M. synoviae plsY:

  • Limited Solubility:

    • Problem: Being a membrane-associated enzyme, plsY often forms inclusion bodies

    • Solution: Express at lower temperatures (16-20°C); use fusion tags like SUMO or MBP; include 0.1% non-ionic detergents (DDM or LDAO) in lysis and purification buffers

  • Protein Instability:

    • Problem: Rapid loss of activity during purification

    • Solution: Include 10% glycerol and 1 mM DTT in all buffers; maintain pH between 7.2-7.5; minimize freeze-thaw cycles; use arginine (50-100 mM) as a stabilizing additive

  • Low Expression Yields:

    • Problem: Poor expression levels in standard systems

    • Solution: Optimize codon usage for E. coli; use strong promoters with tight regulation; consider auto-induction media; test multiple E. coli strains (BL21, C41/C43, Rosetta)

  • Maintaining Enzymatic Activity:

    • Problem: Loss of activity during purification

    • Solution: Include substrate glycerol-3-phosphate (0.5 mM) in purification buffers; keep all steps at 4°C; purify in presence of phospholipids (0.01-0.05% phosphatidylcholine)

These methodological refinements have proven successful for other challenging membrane proteins from M. synoviae and related organisms .

How can researchers differentiate between specific and non-specific activities when characterizing plsY function?

To establish specificity of plsY activity and avoid misinterpreting results:

  • Comprehensive Controls:

    • Inactive enzyme variants (site-directed mutagenesis of catalytic residues)

    • Heat-inactivated enzyme preparations

    • Reactions without acyl-donor substrates

    • Unrelated proteins purified using identical methods

  • Substrate Specificity Analysis:

    • Test activity with multiple acyl-CoA donors of varying chain lengths and saturation

    • Compare activity with the alternate substrate dihydroxyacetone phosphate

    • Competition assays between different substrates

  • Inhibitor Profiling:

    • Evaluate dose-dependent inhibition with known acyltransferase inhibitors

    • Assess compound selectivity across related acyltransferases

    • Determine inhibition mechanisms (competitive, non-competitive)

  • Activity Verification Methods:

    • Confirm product formation using multiple analytical techniques (TLC, LC-MS)

    • Validate enzyme kinetics across different protein concentrations

    • Perform complementation studies in deficient bacterial strains

This methodological framework ensures robust determination of specific plsY activity, similar to approaches used for characterizing other M. synoviae enzymes .

What approaches can address the challenge of studying plsY in the context of the intact Mycoplasmopsis synoviae membrane?

Studying membrane-integrated plsY presents significant challenges. These methodological approaches can help overcome these limitations:

  • Nanodisc Reconstitution:

    • Incorporate purified plsY into nanodiscs with defined lipid composition

    • Allows study of enzyme activity in native-like membrane environment

    • Enables investigation of lipid composition effects on enzyme function

  • Liposome-Based Assays:

    • Reconstitute plsY into liposomes of varying composition

    • Measure activity with externally supplied substrates

    • Evaluate how membrane properties affect enzyme kinetics

  • Genetic Approaches:

    • Generate conditional knockdown strains using antisense RNA

    • Create reporter fusions to monitor localization and expression

    • Perform site-directed mutagenesis to study structure-function relationships

  • Membrane Isolation and Activity Assessment:

    • Fractionate M. synoviae cells to isolate membrane components

    • Perform activity assays on native membrane preparations

    • Compare with recombinant systems to validate physiological relevance

These approaches provide complementary data on plsY function within its native membrane context, similar to methods used for studying membrane localization of other M. synoviae proteins like LP78 .

How does plsY activity correlate with virulence in different Mycoplasmopsis synoviae strains?

Research examining the relationship between plsY activity and virulence could utilize the following experimental design:

  • Comparative Enzymatic Analysis:

    • Isolate native plsY from virulent field strains, vaccine strains (e.g., MS-H), and field reisolates with varying virulence

    • Measure enzymatic parameters (Km, Vmax, substrate preferences)

    • Correlate enzymatic efficiency with in vivo pathogenicity data

  • Expression Level Analysis:

    • Quantify plsY expression during infection using qRT-PCR

    • Compare expression patterns between virulent and attenuated strains

    • Evaluate expression changes in response to host factors

  • Membrane Composition Assessment:

    • Analyze phospholipid profiles of different strains using lipidomics

    • Correlate differences with plsY activity variations

    • Examine membrane fluidity using fluorescence anisotropy

Similar comparative approaches have revealed that mutations in virulence genes like obgE, oppF, and gapdh influence pathogenicity in M. synoviae, with concurrent reversions in these genes associated with higher gross air sac lesion scores and increased tracheal mucosal thickness in experimental chicken models . PlsY activity may similarly correlate with pathogenicity markers due to its role in membrane biogenesis.

What are the implications of plsY inhibition for developing novel antimicrobials against Mycoplasmopsis synoviae?

PlsY represents a promising antimicrobial target due to several favorable characteristics:

  • Essential Function:

    • Inhibition would disrupt phospholipid biosynthesis

    • Limited metabolic bypass pathways in mycoplasmas

    • Critical for membrane integrity and cellular viability

  • Target Validation Strategy:

    • Conditional knockdown to confirm essentiality

    • Phenotypic characterization of depleted strains

    • Correlation of inhibition with growth arrest

  • Inhibitor Development Approach:

    • High-throughput screening of compound libraries

    • Fragment-based drug discovery targeting active site

    • Structure-based design utilizing homology models

  • Potential Advantages Over Current Antimicrobials:

    • Novel mechanism of action reduces cross-resistance

    • Potentially narrow spectrum reducing impact on microbiome

    • Target not present in mammalian cells

This research direction could lead to much-needed alternative treatments for M. synoviae infections, which cause significant economic losses in poultry industries worldwide .

How might data on plsY function inform our understanding of Mycoplasmopsis synoviae host adaptation and tissue tropism?

Understanding plsY function provides insights into M. synoviae's host adaptation mechanisms through several research avenues:

  • Substrate Preference Analysis:

    • Determine whether plsY preferentially utilizes host-derived fatty acids

    • Investigate adaptation to specific tissue microenvironments

    • Examine changes in substrate utilization during infection progression

  • Membrane Composition and Environmental Adaptation:

    • Evaluate how plsY activity modulates membrane composition in response to:

      • Temperature fluctuations (37°C vs. 41°C avian body temperature)

      • pH changes in different host tissues

      • Exposure to host immune factors

  • Comparative Genomics and Evolution:

    • Analyze plsY sequence conservation across M. synoviae isolates

    • Compare with plsY from mycoplasmas with different host ranges

    • Identify adaptive mutations in strains with altered tissue tropism

These investigations could reveal how plsY contributes to M. synoviae's ability to colonize different tissues, similar to how other membrane proteins like LP78 facilitate adhesion to specific host cells and tissues , ultimately enhancing our understanding of the molecular basis for tissue tropism in this important avian pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.