Recombinant Myeloproliferative leukemia virus Myeloproliferative leukemia protein (V-MPL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
V-MPL; Myeloproliferative leukemia protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Myeloproliferative leukemia virus (MpLV)
Target Names
V-MPL
Target Protein Sequence
LELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETAWITLVTALLLVLSLSALL GLLLLKWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPSKATVTDSCEEVEPSLL EILPKSSESTPLPLCPSQPQMDYRGLQPCLRTMPLSVCPPMAETGSCCTTHIANHSYLPL SYWQ
Uniprot No.

Target Background

Function

Truncated form of the thrombopoietin receptor.

Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the relationship between c-MPL and v-MPL at the molecular level?

V-MPL represents a truncated form of the c-MPL gene encoding the thrombopoietin receptor. Specifically, v-MPL originates from cellular sequences that have been transduced in frame with the deleted and rearranged Friend murine leukemia virus env gene, resulting in the env-mpl fusion oncogene . This oncogene is responsible for inducing acute myeloproliferative disorders in mice. The resulting fusion protein retains critical structural elements of the original receptor but lacks regulatory domains, which contributes to its constitutive activation. The truncation affects primarily the extracellular domain while preserving the transmembrane and cytoplasmic signaling regions necessary for downstream pathway activation.

How does the structural modification of v-MPL contribute to its constitutive activation?

The constitutive activation of v-MPL stems from critical structural modifications in the extracellular domain. Research has demonstrated that even when 22 amino acids of the Env signal peptide, all mature Env sequences, and 18 N-terminal amino acids of the v-MPL extracellular domain are deleted (as in DEL3MPLV), the resulting product remains oncogenic . This variant retains only 12 amino acids of the Env signal sequence (including a crucial cysteine residue) and 25 amino acids of v-MPL in its extracellular region. The cysteine residue plays a pivotal role, as mutation of this cysteine to glycine completely abolishes oncogenicity. Mechanistically, this cysteine facilitates disulfide-linked homodimerization, leading to constitutive activation of the receptor in the absence of thrombopoietin binding . This structural insight provides fundamental understanding of how minimal modifications in receptor architecture can drive pathological signaling.

What are the key downstream signaling pathways activated by v-MPL?

V-MPL activation triggers multiple downstream signaling cascades that contribute to cellular proliferation and survival. The primary pathways include JAK/STAT signaling, particularly STAT3 and STAT5, as well as the RAS/RAF/MAPK and PI3K/AKT pathways. Experimental evidence from murine models shows that constitutive activation of these pathways leads to cytokine-independent growth of hematopoietic progenitors. When studying these pathways, researchers typically employ phosphorylation-specific antibodies in western blotting and immunoprecipitation assays to track the activated forms of these signaling molecules. Alternatively, reporter gene assays utilizing STAT-responsive elements can be employed to quantify pathway activation. Understanding these signaling networks is crucial for developing targeted interventions against MPL-driven malignancies.

How do different MPL mutations contribute to leukemic transformation of myeloproliferative neoplasms?

MPL mutations play diverse roles in the leukemic transformation of myeloproliferative neoplasms (MPNs). The W515L mutation, found in both essential thrombocythemia (ET) and primary myelofibrosis (PMF), is particularly significant . Research has revealed that patients with an MPL W515L-positive MPN can progress to acute myeloid leukemia (AML) as part of the natural disease course, even without prior cytoreductive therapy .

During transformation, three key mechanisms have been identified:

  • Retention of the MPL mutation in leukemic blasts, indicating direct progression from the MPL-mutant clone

  • Loss of wild-type MPL through mitotic recombination, suggesting selection pressure favoring homozygosity

  • Acquisition of additional mutations, particularly in tumor suppressor genes like TP53

Detailed clonal analysis using progenitor colony assays demonstrates that leukemic transformation involves the expansion of multiple genetically distinct but phylogenetically related clones . This pattern mirrors observations in other pre-malignant conditions where clonal diversity precedes full malignant transformation. Methodologically, researchers should employ purified blast populations to accurately determine mutation status and perform copy number variation analysis to distinguish between mitotic recombination and allelic deletion.

What techniques should be used to detect and quantify MPL mutant allele burden?

Detecting and quantifying MPL mutant allele burden requires sophisticated molecular techniques with appropriate sensitivity and specificity. The recommended methodological approach includes:

  • Allele-Specific PCR: Enables detection of specific mutations like W515L and T487A with high sensitivity

  • Digital PCR: Provides absolute quantification with detection limits as low as 0.1%

  • Next-Generation Sequencing (NGS): Allows broader mutational screening with quantitative assessment

For optimal results, researchers should:

  • Isolate specific cell populations (e.g., CD34+ cells for progenitor analysis) using immunomagnetic selection to achieve ≥90% purity

  • Perform copy number analysis using real-time PCR to distinguish between heterozygous mutation, homozygous mutation due to deletion, and homozygous mutation due to mitotic recombination

  • Include control genes and reference samples with known allele burdens to ensure accuracy

  • Consider single-cell sequencing for heterogeneous samples to trace clonal evolution

A mutant allele burden exceeding 50% often indicates duplication of the mutant MPL allele through mitotic recombination, which has been observed in patients with MPL-mutant primary myelofibrosis and occasionally in essential thrombocythemia .

How can mitotic recombination leading to MPL mutant homozygosity be experimentally demonstrated?

Mitotic recombination resulting in MPL mutant homozygosity can be experimentally demonstrated through a systematic approach combining several techniques:

  • Sequence Analysis: First establish homozygosity by demonstrating absence of the wild-type allele in purified cell populations using Sanger sequencing or NGS

  • Copy Number Assessment: Perform real-time PCR targeting the MPL locus to confirm retention of two copies of the gene, which distinguishes mitotic recombination from deletion of the wild-type allele

  • LOH Mapping: Analyze single nucleotide polymorphisms (SNPs) both at the MPL locus and at distant sites (e.g., 39Mb distal, near the 1p telomere) to map the region of loss of heterozygosity

  • Microsatellite Analysis: Use polymorphic microsatellite markers spanning chromosome 1p to confirm the extent of the recombination event

In published research, combined analysis of homozygosity by sequencing and copy number assessment by real-time PCR has effectively demonstrated that MPL W515L homozygosity arises through mitotic recombination rather than through acquisition of a second mutation or deletion of the wild-type allele . This approach mirrors methodologies used in studying other signaling pathway mutations like JAK2 V617F and FLT3-ITD, where mitotic recombination leads to duplication of the mutant allele, presumably providing selective advantage through increased mutant gene dosage or elimination of wild-type allele function.

What are the optimal experimental models for studying v-MPL-induced leukemogenesis?

The study of v-MPL-induced leukemogenesis can be approached using several complementary experimental models, each with particular strengths:

  • Murine Retroviral Models: The original and still highly relevant approach involves infection of mice with MPLV or engineered variants like DEL3MPLV . These models reliably produce acute myeloproliferative disorders and allow study of disease progression in vivo. Key methodological considerations include:

    • Viral titer standardization

    • Age-matched control groups

    • Comprehensive hematological assessment

    • Bone marrow histopathology evaluation

  • Bone Marrow Transplantation Models: Transduction of murine hematopoietic stem cells with v-MPL-expressing vectors followed by transplantation into irradiated recipients allows assessment of cell-autonomous effects and permits genetic manipulation of donor cells.

  • Patient-Derived Xenografts (PDX): For human-relevant studies, immunocompromised mice engrafted with primary cells from MPL-mutant MPN or AML patients provide a platform for studying human disease biology and therapeutic responses.

  • In Vitro Systems: Cytokine-dependent cell lines (e.g., Ba/F3, UT-7) transduced with various MPL constructs enable mechanistic studies and high-throughput drug screening.

The optimal approach depends on specific research questions, with combined models typically providing the most comprehensive insights into v-MPL biology and pathogenesis.

How can one track clonal evolution during MPL-mutant MPN progression to AML?

Tracking clonal evolution during progression from MPL-mutant MPN to AML requires serial sampling and sophisticated molecular analysis techniques:

  • Sequential Sampling Strategy:

    • Collect paired samples at MPN diagnosis and AML transformation

    • When feasible, obtain intermediate time points to capture evolution in real-time

    • Isolate different cell populations (progenitors, mature cells, blasts) to track lineage-specific changes

  • Molecular Tracking Techniques:

    • Colony formation assays from single progenitor cells, followed by genotyping of individual colonies to identify co-existing clones

    • Deep sequencing of a panel of myeloid-associated genes to detect emerging subclones

    • Single-cell DNA sequencing to directly observe genetic heterogeneity and construct phylogenetic trees

Research has demonstrated the parallel expansion of genetically distinct but phylogenetically related clones prior to leukemic transformation . Evidence suggests that clonal diversity, assessed by loss of heterozygosity and mutation profiles in genes like TP53 and CDKN2A, may predict progression to a more aggressive phenotype, similar to observations in other premalignant conditions like Barrett's esophagus .

This methodological approach has revealed that MPL-mutant leukemic transformation often involves complex clonal architecture rather than simple linear evolution, with multiple subclones acquiring different secondary mutations while maintaining the original MPL driver mutation.

What methodological approaches allow differentiation between MPL-dependent and MPL-independent leukemic transformation?

Differentiating between MPL-dependent and MPL-independent leukemic transformation requires a comprehensive methodological toolkit:

  • Mutational Analysis of Purified Populations:

    • CD34-immunomagnetic selection of leukemic blasts (ensuring ≥90% purity)

    • Targeted sequencing of MPL in both the original MPN and AML samples

    • Determination of variant allele frequencies in matched samples

  • Functional Dependency Testing:

    • RNA interference or CRISPR-mediated knockout of MPL in leukemic cells

    • Small molecule inhibitors targeting MPL or downstream pathways

    • Assessment of cellular viability, proliferation, and differentiation following MPL inhibition

  • Signaling Pathway Profiling:

    • Phosphoproteomic analysis to map active signaling networks

    • Comparison of signaling patterns between MPL-mutant MPN and subsequent AML

    • Identification of bypass mechanisms that might render cells MPL-independent

Research has shown that while some JAK2 V617F-positive MPNs develop into JAK2-negative AML, patients with MPL W515L mutations often retain the mutation in their leukemic blasts . This suggests that MPL-mutant progression to AML frequently occurs through continued dependence on the original driver mutation, which has important implications for therapeutic strategies targeting MPL signaling in advanced disease.

How should researchers reconcile conflicting data regarding the leukemogenic potential of different MPL mutations?

Researchers facing conflicting data on the leukemogenic potential of different MPL mutations should implement a systematic approach to reconcile these discrepancies:

  • Standardized Mutation Classification:

    • Create a comprehensive database of all reported MPL mutations with standardized nomenclature

    • Classify mutations by location (e.g., transmembrane domain, cytoplasmic domain)

    • Distinguish acquired somatic from germline mutations

  • Context-Dependent Analysis:

    • Evaluate mutations in the context of co-occurring genetic alterations

    • Consider disease background (ET vs. PMF vs. de novo AML)

    • Account for patient characteristics and treatment history

  • Functional Stratification:

    • Compare constitutive activation levels across different mutations using standardized assays

    • Assess differential activation of downstream pathways

    • Determine cytokine sensitivity alterations

Current evidence suggests that mutations like MPL W515L are associated with progression to AML, as seen in patients with preceding MPL W515L-positive MPN . Conversely, the MPL T487A mutation, identified in de novo AML, was not detected in a cohort of 172 MPN patients, suggesting distinct functional consequences .

The methodological approach to resolving these discrepancies should include: (1) larger cohort studies with long-term follow-up, (2) standardized functional assays, and (3) comprehensive genetic profiling to identify modifying factors that influence leukemogenic potential.

What explains the heterogeneity in clinical outcomes among patients with identical MPL mutations?

The heterogeneity in clinical outcomes among patients with identical MPL mutations represents a significant research challenge that requires multifaceted analysis:

Contributing FactorAssessment MethodSignificance
Genetic backgroundComprehensive genomic profilingIdentifies co-occurring mutations that modify disease phenotype
Clonal architectureSingle-cell sequencing, VAF analysisReveals subclone structure and evolution patterns
Epigenetic contextDNA methylation profiling, ChIP-seqUncovers non-genetic factors affecting gene expression
Microenvironmental factorsBone marrow histology, cytokine profilingDetermines external influences on mutant clone behavior
Host immunityImmune cell phenotyping, cytokine analysisEvaluates immune surveillance affecting disease progression

Research has demonstrated that even with the same MPL W515L mutation, patients show variable progression from chronic phase MPN to acute leukemia . This heterogeneity likely results from the acquisition of different secondary genetic alterations, particularly in genes governing genomic stability and tumor suppression like TP53.

The methodological approach to addressing this heterogeneity should include longitudinal studies with serial sampling to capture the dynamic nature of disease evolution, combined with comprehensive genetic characterization to identify risk factors for adverse outcomes.

What novel therapeutic strategies targeting v-MPL show the most promise for clinical development?

Several novel therapeutic strategies targeting v-MPL show significant promise for clinical development:

  • Direct MPL Inhibition:

    • Small molecule inhibitors that specifically target mutant MPL conformations

    • Peptide-based inhibitors that disrupt MPL dimerization

    • Methodological approach: Structure-based drug design coupled with high-throughput screening

  • Targeted Protein Degradation:

    • PROTAC (Proteolysis Targeting Chimera) technology to selectively degrade MPL

    • Ubiquitin-proteasome pathway exploitation

    • Methodological approach: Design of bifunctional molecules linking MPL-binding warheads to E3 ligase recruiters

  • Immunotherapeutic Approaches:

    • Bispecific antibodies targeting MPL and immune effector cells

    • CAR-T cells directed against MPL-overexpressing leukemic blasts

    • Methodological approach: Antibody engineering combined with functional immune assays

  • Synthetic Lethality Exploitation:

    • Identification of genes selectively essential in MPL-mutant contexts

    • Development of inhibitors targeting these synthetic lethal partners

    • Methodological approach: CRISPR-Cas9 screening in isogenic cell line pairs

Given that MPL mutations can persist during leukemic transformation and that constitutive activation occurs through mechanisms like disulfide-linked homodimerization , approaches targeting these specific structural abnormalities may provide selective therapeutic windows with minimal impact on normal hematopoiesis.

How might single-cell technologies advance our understanding of MPL-driven leukemic transformation?

Single-cell technologies offer unprecedented opportunities to dissect the complexity of MPL-driven leukemic transformation:

  • Single-Cell Genomic Profiling:

    • Enables precise mapping of clonal architecture

    • Reveals rare subpopulations that might be missed in bulk analysis

    • Methodological approach: Single-cell DNA sequencing with targeted amplification of MPL and related genes

  • Single-Cell Transcriptomics:

    • Identifies distinct transcriptional programs in different cellular subsets

    • Uncovers early molecular changes preceding phenotypic transformation

    • Methodological approach: scRNA-seq with computational trajectory analysis

  • Multi-Omics Integration:

    • Combines genomic, transcriptomic, and epigenomic data from the same cells

    • Provides comprehensive view of cellular states during transformation

    • Methodological approach: CITE-seq, ATAC-seq, methylation profiling on indexed single cells

  • Spatial Transcriptomics:

    • Preserves tissue context and microenvironmental interactions

    • Maps the spatial distribution of evolving clones

    • Methodological approach: In situ sequencing or slide-based spatial technologies

These technologies would significantly advance the findings from previous studies that demonstrated the parallel expansion of genetically distinct but phylogenetically related clones prior to leukemic transformation . By providing higher resolution analysis, single-cell approaches could identify the earliest events in transformation and potentially reveal new therapeutic vulnerabilities or biomarkers for disease progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.