Recombinant MT-CYB is synthesized using heterologous expression systems such as Escherichia coli or baculovirus . Key features include:
Gene Source: Mitochondrial DNA (MT-CYB gene, UniProt ID: Q36294) .
Function: Electron transfer from ubiquinol to cytochrome c, contributing to proton gradient generation for ATP production .
Applications: Studies of mitochondrial disorders, enzyme activity assays, and structural biology .
MELAS Syndrome: A novel heteroplasmic mutation (m.14864 T>C) in MT-CYB was linked to MELAS-like symptoms, including migraines, epilepsy, and stroke-like episodes . This mutation substitutes cysteine with arginine at position 40 (C40R), disrupting Complex III function .
Complex III Deficiency: MT-CYB mutations reduce oxidative phosphorylation capacity, leading to energy deficits in high-demand tissues (muscle, brain, heart) .
Conservation: Cytochrome b’s cysteine residues are evolutionarily conserved, underscoring their functional importance .
Mutation Load: Pathogenic MT-CYB variants show heteroplasmy (32–57% mutation load across tissues), correlating with symptom severity .
| Host System | Advantages | Yield |
|---|---|---|
| E. coli | Cost-effective, rapid production | High |
| Baculovirus | Post-translational modifications, solubility | Moderate to high |
Research priorities include:
Recombinant Myotis leibii Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This proton gradient is crucial for ATP synthesis.
Cytochrome b (MT-CYB) from Myotis leibii (Eastern small-footed myotis) is a mitochondrially-encoded protein that forms an essential component of the electron transport chain's Complex III (also known as ubiquinol-cytochrome-c reductase complex) . This protein has gained significant importance in molecular research due to its highly conserved regions interspersed with variable sequences, making it particularly valuable for phylogenetic studies and species identification in chiropteran (bat) research . The gene's evolutionary rate provides sufficient variation for distinguishing between closely related species while maintaining structural similarities across diverse taxa . As a mitochondrial marker, it offers insights into maternal lineage patterns and evolutionary relationships, which is particularly valuable when examining speciation events, hybridization, and genetic diversity in bat populations .
The Myotis leibii cytochrome b consists of 176 amino acids in its recombinant form . Its amino acid sequence (MTNIRKSHPLIKIVNSSFIDLPAPSNISSWWNFGSLLGICLALQILTGLFLAMHYTSDTATAFNSVTHICRDVNYGWILRYLHANGASMFFICLYLHVGRGLHYGSYMYTETWNIGVTPLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLAEWIWGGFSVDKATLT) demonstrates high conservation within the Myotis genus, which allows for reliable comparative studies . Phylogenetic analyses of cytochrome b sequences have revealed that Myotis species show deterministic ecomorphological convergences, where bats with similar ecological adaptations display similar morphological features despite not being closely related genetically . This makes the cytochrome b gene particularly valuable for resolving taxonomic uncertainties within the Myotis genus, which contains numerous morphologically similar species . Comparative studies have demonstrated that while certain regions of the protein are highly conserved across all bat species, variable regions can be effectively used to distinguish between even closely related Myotis species .
Recombinant Myotis leibii Cytochrome b should be stored in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For short-term storage (up to one week), working aliquots can be maintained at 4°C, while for extended storage, it is recommended to keep the protein at -20°C or -80°C to preserve its structural integrity and activity . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of functionality, making it advisable to prepare single-use aliquots when dividing the stock solution . When handling the protein for experimental purposes, researchers should maintain appropriate cold chain conditions and minimize exposure to proteases, extreme pH conditions, and detergents that could compromise protein stability . Proper storage and handling conditions are critical for maintaining the native conformation of the protein, particularly for applications requiring biological activity or structural studies.
Several effective primer designs have been reported for amplifying the cytochrome b gene from Myotis species, including M. leibii. Universal primers for cytochrome b amplification include the L14724–MVZ16 pair and the L15162–H15915 pair, which have been successfully used to generate overlapping PCR products covering the complete cytochrome b gene . For a 148 bp fragment of the cytochrome b gene, the universal primers L15601 (5'-TACGCAATCCTACGATCAATTCC-3') and H15748 (5'-GGTTGTCCTCCAATTCATGTTAG-3') have proven effective across multiple species . For optimal amplification results, PCR reactions typically include 5 μL of DNA extract (approximately 1 ng/μL), 0.2 μM of each primer, 2.5 mM MgCl₂, 0.8 mM dNTP, and 1 unit of Taq polymerase with appropriate buffer . Standard thermal cycling conditions involve an initial denaturation at 94°C for 3 minutes, followed by 30-35 cycles of denaturation, annealing (typically at 50-55°C for cytochrome b), and extension steps .
Validation of recombinant Myotis leibii MT-CYB authenticity and purity requires a multi-faceted approach. SDS-PAGE analysis should be conducted to confirm the expected molecular weight (approximately 18-20 kDa for the 176 amino acid recombinant fragment) . Western blotting using antibodies specific to the protein or to any fusion tags should be performed to verify protein identity . For recombinant proteins with specific tags, appropriate detection methods (e.g., anti-His antibodies for His-tagged proteins) can provide additional confirmation . Protein purity can be assessed through densitometric analysis of SDS-PAGE gels, with research-grade preparations typically requiring >90% purity . Mass spectrometry analysis, particularly peptide mass fingerprinting, provides the most definitive validation by matching observed peptide masses with those predicted from the known MT-CYB sequence . Functional assays measuring electron transport activity or binding to known interaction partners can further validate the proper folding and biological activity of the recombinant protein.
Contradictory phylogenetic signals between MT-CYB and nuclear genes in Myotis species often result from biological phenomena such as mitochondrial introgression, incomplete lineage sorting, or hybridization . To resolve these discrepancies, researchers should employ a multi-faceted approach. The first step involves comprehensive sampling of both mitochondrial (MT-CYB) and multiple unlinked nuclear markers (such as RAG2) from the same individuals across geographical ranges to identify patterns of discordance . Statistical tests for introgression, such as ABBA-BABA tests or approximate Bayesian computation methods, can help distinguish between incomplete lineage sorting and hybridization scenarios . Bayesian analysis of admixture can quantify hybridization rates, as demonstrated in studies of Myotis myotis and Myotis blythii where approximately 25% of sampled M. blythii showed introgressed genes of M. myotis origin, while less than 4% of analyzed M. myotis were classified as non-parental genotypes . The integration of coalescent-based species tree methods that explicitly model gene tree heterogeneity can help reconcile discordant gene histories . Additionally, geographical analysis of genetic patterns can reveal contact zones where hybridization may occur or historical biogeographical events that shaped current genetic distributions .
Distinguishing between natural sequence variation and PCR-induced errors in MT-CYB sequences requires a systematic analytical approach. Researchers should implement high-fidelity DNA polymerases with proofreading capabilities to minimize error introduction during amplification . Multiple independent PCR reactions from the same DNA sample should be performed and sequenced to identify consistent versus sporadic base differences . Bidirectional sequencing (using both forward and reverse primers) allows for validation of potential variants through sequence overlap comparison . When analyzing sequences, researchers should examine the chromatogram quality at positions of interest, as true biological variation typically yields clean peaks while PCR errors often display underlying secondary peaks . For phylogenetic studies, singleton mutations (appearing in only one sequence) should be treated with caution and verified through additional sequencing or restriction enzyme analysis . The pattern of substitutions should be analyzed, as PCR errors typically occur randomly while natural variation often follows evolutionary patterns (e.g., higher frequency of transitions versus transversions in mitochondrial genes) . Additionally, comparing obtained sequences with published data from the same species can help identify unusual substitutions that might represent artifacts rather than true biological variation .
Expressing functional Myotis leibii MT-CYB in heterologous systems presents several challenges due to its hydrophobic nature and mitochondrial origin. To overcome these challenges, researchers should consider using specialized expression vectors designed for membrane proteins, which include appropriate signal sequences and fusion partners to facilitate proper folding . Expression hosts with robust machinery for membrane protein production, such as C41(DE3) or C43(DE3) E. coli strains, Pichia pastoris, or insect cell systems, often yield better results than standard laboratory strains . Optimization of growth and induction conditions is critical—lower temperatures (16-25°C), reduced inducer concentrations, and extended expression periods can improve the yield of correctly folded protein . Co-expression with chaperone proteins can assist in proper folding, while the addition of specific lipids or detergents to the growth medium may help stabilize the hydrophobic regions of the protein . For purification, careful selection of detergents is essential—mild non-ionic detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often prove effective for extracting membrane proteins while maintaining their native conformation . Finally, functional validation through activity assays or binding studies should be performed to confirm that the expressed protein retains its biological properties.
Heteroplasmy—the presence of multiple mitochondrial DNA variants within a single sample—presents significant challenges in MT-CYB analysis from clinical or environmental samples. To address this issue effectively, researchers should implement several methodological approaches. Next-generation sequencing (NGS) technologies with high coverage (>1000×) enable detection and quantification of low-frequency variants that might be missed by traditional Sanger sequencing . When heteroplasmy is suspected in Sanger sequencing data, cloning of PCR products followed by sequencing of multiple clones can help resolve and quantify the different haplotypes present . For tissues with varying levels of heteroplasmy, analysis of multiple tissue types from the same individual (e.g., muscle, blood, fibroblasts, and urinary sediment) can provide insights into tissue-specific segregation patterns, as observed in clinical cases of MT-CYB mutations . Quantitative approaches such as allele-specific PCR, high-resolution melt analysis, or digital PCR can be employed to determine the precise ratio of different mitochondrial variants within a sample . When analyzing environmental samples or mixed DNA sources, species-specific primers can help isolate the target MT-CYB sequences from contaminants . For phylogenetic studies involving potentially heteroplasmic samples, consensus sequences should be used with caution, and methods that explicitly account for intra-individual variation should be preferred .
Working with MT-CYB from multiple Myotis species requires stringent protocols to prevent cross-contamination, particularly given the sensitivity of PCR-based detection methods. Physical separation of pre-PCR and post-PCR workflows is essential, with dedicated equipment, reagents, and preferably separate rooms for each stage . Implementation of unidirectional workflow practices ensures that samples only move from preparation areas to amplification areas and never in reverse . Species should be processed sequentially rather than in parallel when possible, with thorough decontamination of work surfaces and equipment between batches . The use of filter tips, frequent glove changes, and aliquoting of reagents minimizes the risk of contamination from aerosols or handling . Inclusion of appropriate negative controls (extraction blanks and PCR negative controls) in every batch allows for detection of potential contamination events . For studies involving museum specimens or environmental samples, where DNA may be degraded or in low concentrations, researchers should incorporate positive controls of known concentration to verify assay performance while monitoring for potential contamination . When amplifying similar MT-CYB regions from multiple species, designing species-specific primers or using nested PCR approaches with increasing specificity can help ensure amplification of only the target species' DNA . Additionally, all samples should be clearly labeled and tracked throughout the workflow to prevent mix-ups that could be mistaken for biological phenomena such as hybridization or introgression .
For population genetics studies utilizing MT-CYB sequence data from Myotis species, several statistical approaches are particularly informative. Measures of genetic diversity, including haplotype diversity (Hd), nucleotide diversity (π), and the average number of nucleotide differences (k), should be calculated to assess population variability . For examining population structure, F-statistics (particularly FST) are valuable, as demonstrated in studies of M. myotis and M. blythii where differentiation between populations was quantified (FST=0.18) . Phylogeographic analyses using network-based approaches, such as TCS networks, effectively visualize relationships among haplotypes and can reveal patterns of historical population expansion, contraction, or isolation . Tests for selective neutrality, including Tajima's D and Fu's Fs, should be applied to detect signatures of selection or demographic changes in the populations . For detecting isolation by distance, Mantel tests correlating genetic and geographic distances can reveal spatial patterns of genetic variation . When investigating hybridization or introgression, Bayesian analysis of admixture provides quantitative estimates of gene flow between species, as shown in studies where approximately 25% of sampled M. blythii exhibited introgressed genes from M. myotis . For demographic history reconstruction, mismatch distribution analysis and Bayesian skyline plots can infer historical population size changes . When comparing multiple populations across geographic barriers, Analysis of Molecular Variance (AMOVA) partitions genetic variation within and among populations and regions .
Conflicts between morphological classification and MT-CYB phylogenetics in Myotis species require careful interpretation considering several biological phenomena. Researchers should first consider the possibility of ecomorphological convergence, where similar morphological adaptations evolve independently in response to similar ecological pressures, as documented extensively in the Myotis genus . The phenomenon of deterministic ecomorphological convergences has led to the traditional subdivision of Myotis into four major subgenera based on morphology, which molecular data have subsequently shown to be polyphyletic . Mitochondrial introgression due to hybridization can result in discordance between mitochondrial and nuclear phylogenies, as observed between M. myotis and M. blythii in Europe, where European M. blythii share identical or very similar MT-CYB haplotypes with M. myotis despite maintaining well-differentiated nuclear gene pools . Incomplete lineage sorting, particularly in recently diverged species, can also lead to discordance between genes and morphology . To resolve these conflicts, researchers should implement an integrative taxonomic approach combining mitochondrial markers, multiple nuclear markers, morphological analysis, and ecological data . Geographical patterns should be carefully examined, as demonstrated in studies of M. myotis where the Alps constitute a major barrier to gene flow, structuring both mitochondrial and nuclear diversity . When hybridization is suspected, researchers should quantify admixture and determine whether it follows symmetric or asymmetric patterns, as seen in the M. myotis/M. blythii system where hybridization appears to be unidirectional .
For comprehensive phylogenetic analysis integrating MT-CYB with other genetic markers in Myotis research, several bioinformatic pipelines and approaches are recommended. Multi-gene analyses should begin with independent gene tree reconstruction for each marker (MT-CYB and nuclear genes such as RAG2) using models specifically optimized for each gene partition . For model selection, hierarchical likelihood ratio tests implemented in programs like Modeltest can determine the most appropriate nucleotide substitution model for each partition (GTR+Γ8+I for MT-CYB and HKY+Γ8+I for RAG2 have been identified as appropriate models in Myotis studies) . When combining datasets, partition-homogeneity tests should be performed to assess congruence between different gene regions before conducting concatenated analyses . For Bayesian inference of combined datasets, software like MrBayes allows independent estimation of model parameters for each gene partition while simultaneously analyzing the combined data . Species tree methods that accommodate gene tree discordance, such as *BEAST or ASTRAL, should be employed when gene trees show significant incongruence due to biological processes like incomplete lineage sorting or introgression . For visual representation of conflicting phylogenetic signals, tools that generate consensus networks or split networks can highlight areas of strong disagreement between markers . When interpreting complex evolutionary scenarios involving hybridization, software packages implementing coalescent models with gene flow (such as IMa2 or G-PhoCS) can estimate historical and contemporary introgression rates between populations or species . Finally, sensitivity analyses altering taxon sampling, outgroup selection, alignment methods, and analytical parameters should be conducted to assess the robustness of the resulting phylogenetic hypotheses .
Emerging technologies are poised to revolutionize MT-CYB analysis in field-based bat research through several innovative approaches. Portable sequencing platforms, such as the Oxford Nanopore MinION, enable real-time sequencing of MT-CYB and other genetic markers directly in the field, eliminating the need for sample transport to laboratories and allowing immediate species identification and population assessment . Advanced environmental DNA (eDNA) techniques targeting MT-CYB from environmental samples (water, soil, or guano) can detect bat presence and diversity without direct capture, minimizing disturbance to sensitive populations . CRISPR-based diagnostic systems could be developed for rapid field detection of specific Myotis species through targeted recognition of distinctive MT-CYB sequences . Digital PCR technologies offer enhanced sensitivity for detecting low-abundance MT-CYB variants in mixed samples, facilitating the study of cryptic species or hybridization events in complex field settings . Machine learning algorithms applied to MT-CYB sequence data could enable automated species identification and population assignment, streamlining field research workflows . Integration of genetic data with real-time ecological monitoring through networked sensors could correlate MT-CYB variants with behavioral patterns, habitat preferences, and environmental changes . For comprehensive population studies, single-cell sequencing techniques might be adapted for minimally invasive sampling from individual bats, potentially using modified buccal swabs or hair follicles as DNA sources .
MT-CYB analysis offers significant potential for understanding bat-associated zoonotic disease transmission through several research avenues. Accurate species identification using MT-CYB sequencing is crucial for epidemiological studies, as different Myotis species may harbor distinct pathogen assemblages with varying zoonotic potential . Phylogeographic analysis of MT-CYB sequences can reveal bat population movements and connectivity patterns that influence disease spread dynamics across landscapes . Integration of host MT-CYB data with pathogen genetic data enables co-phylogenetic analyses to understand host-pathogen co-evolution and identify evolutionary associations that may predispose certain bat lineages to carry specific pathogens . The universal primers used for MT-CYB amplification (L15601/H15748) allow consistent species identification from diverse sample types, including putrefied samples, facilitating pathogen surveillance in challenging field conditions . Heteroplasmy analysis in MT-CYB could potentially serve as a biomarker for physiological stress or immune activation in response to infection, providing insights into subclinical disease states in bat populations . Comparative analysis of MT-CYB variation between bat colonies with different pathogen prevalence might identify genetic factors associated with resistance or susceptibility to infection . For comprehensive surveillance programs, MT-CYB barcoding can be coupled with metagenomic approaches to simultaneously identify bat species and characterize their associated viral, bacterial, and fungal communities, creating an integrated picture of potential zoonotic transmission networks .
Structural biology approaches using recombinant Myotis leibii MT-CYB offer promising avenues for understanding the unique metabolic adaptations and exceptional longevity of bats. High-resolution structural determination of recombinant MT-CYB through X-ray crystallography or cryo-electron microscopy can reveal bat-specific structural features that might contribute to efficient respiratory chain function during the high metabolic demands of flight . Comparative structural analysis between bat and human cytochrome b could identify adaptive changes that potentially enhance electron transport efficiency or reduce reactive oxygen species (ROS) production, contributing to the exceptional longevity of bats relative to similar-sized mammals . Site-directed mutagenesis studies introducing bat-specific amino acid substitutions into human cytochrome b (or vice versa) followed by functional assays can determine the physiological significance of these structural differences . Protein-protein interaction studies using recombinant MT-CYB as bait can identify binding partners within the respiratory chain, potentially revealing unique regulatory mechanisms in bat mitochondria . Molecular dynamics simulations comparing the conformational flexibility and stability of bat versus human cytochrome b under various physiological conditions (pH, temperature, oxidative stress) might elucidate structural adaptations relevant to the extreme metabolic shifts bats experience during torpor and arousal . Integration of structural data with evolutionary analyses can identify positively selected residues in bat MT-CYB that may represent adaptive responses to the metabolic demands of powered flight . Finally, functional studies examining the kinetic properties of recombinant MT-CYB under conditions mimicking hibernation, torpor, and active flight could provide insights into the molecular basis of bats' remarkable metabolic flexibility .
For beginners working with MT-CYB in bat research, several essential laboratory protocols must be mastered to ensure successful outcomes. DNA extraction from bat tissue samples (wing membrane punches, blood, or muscle) should follow specialized protocols that maximize yield while minimizing PCR inhibitors; commercial kits designed for animal tissues generally provide consistent results . PCR amplification of the cytochrome b gene requires careful primer selection—for complete gene amplification, the L14724–MVZ16 and L15162–H15915 primer pairs are recommended, while the L15601–H15748 pair effectively amplifies a 148 bp diagnostic fragment . The PCR reaction mixture typically consists of 5 μL DNA extract (diluted to 1 ng/μL), 0.2 μM each primer, 2.5 mM MgCl₂, 0.8 mM dNTP, and 1 unit of Taq polymerase with appropriate buffer . Thermal cycling conditions generally include initial denaturation at 94°C for 3 minutes, followed by 35 cycles of denaturation (94°C, 30 seconds), annealing (50-55°C, 30 seconds), and extension (72°C, 1 minute/kb), with a final extension at 72°C for 10 minutes . DNA sequencing should be performed bidirectionally for accuracy, and chromatograms must be carefully examined for quality before phylogenetic analysis . For recombinant protein work, expression in E. coli systems using pET vectors with appropriate tags facilitates purification, though adaptation of growth conditions (reduced temperature, specialized media) may be necessary for optimal expression . Purification typically employs affinity chromatography based on the fusion tag, followed by size exclusion chromatography to achieve high purity .
Researchers conducting MT-CYB studies in Myotis species can access numerous reliable resources for reference sequences and analytical tools. For reference sequences, GenBank (www.ncbi.nlm.nih.gov/genbank/) provides the most comprehensive collection of MT-CYB sequences, with complete mitochondrial genomes available for multiple Myotis species . The Barcode of Life Data System (BOLD; www.boldsystems.org) offers curated cytochrome b sequences with associated voucher information for many bat species . For phylogenetic analysis, PAUP* (Phylogenetic Analysis Using Parsimony) offers comprehensive methods for maximum parsimony analyses with the ability to implement appropriate transition/transversion weightings (typically 11-13× for MT-CYB) . PHYML provides efficient maximum likelihood reconstruction with the GTR+Γ8+I model, which has been determined appropriate for MT-CYB in Myotis studies . MrBayes enables Bayesian phylogenetic inference with partition-specific model parameters for combined analyses of MT-CYB with nuclear markers . For network visualization of closely related haplotypes, TCS software implements statistical parsimony networks that effectively display relationships among MT-CYB sequences . Population genetic analyses can be performed using Arlequin, which calculates diversity indices, tests selective neutrality, and implements Analysis of Molecular Variance (AMOVA) . For detecting hybridization and introgression, STRUCTURE software performs Bayesian analysis of admixture to quantify gene flow between species . Sequence alignment tools such as MUSCLE or MAFFT provide accurate alignments of MT-CYB sequences, though manual inspection is still recommended . For integrated analyses, the BEAST package offers sophisticated Bayesian evolutionary analysis including divergence time estimation and demographic reconstruction based on MT-CYB data .