Recombinant Myotis lucifugus UPF0767 protein C1orf212 homolog

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Myotis lucifugus UPF0767 Protein C1orf212 Homolog

This recombinant protein is a full-length homolog of the human C1orf212 protein, expressed in E. coli and tagged with an N-terminal His-tag for purification. Key features include:

ParameterSpecificationSource
UniProt IDG1QDE8
AA SequenceMWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVLSLKDKLEFAPKAVLNRNRPEKN
Protein LengthFull-length (1–92 amino acids)
Expression HostE. coli
TagN-terminal His-tag
Gene NameUPF0767 (homolog of C1orf212)

The protein is part of the UPF0767 family, characterized as small integral membrane proteins (SMIM12 in mice) . While its exact function remains unclear, homologs in other species suggest roles in membrane stability or transport .

Production and Quality Control

The recombinant protein is purified to >90% purity via SDS-PAGE . Critical production details include:

ParameterSpecificationSource
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
ReconstitutionSterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended for stability
Handling NotesAvoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week

The protein is lyophilized and shipped in quantities of 50 µg or larger, with bulk orders available upon inquiry .

Comparative Analysis with Mouse SMIM12

The Myotis lucifugus UPF0767 shares ~80% sequence identity with mouse SMIM12, a small integral membrane protein . Both are expressed in E. coli and His-tagged, but differences in buffer composition (e.g., trehalose vs. glycerol) reflect optimized stability for each species .

ParameterMouse SMIM12Myotis lucifugus UPF0767
Storage BufferTris/PBS + 6% trehaloseTris + 50% glycerol
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
UniProt IDQ78RX3G1QDE8

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMIM12; Small integral membrane protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-92
Protein Length
full length protein
Species
Myotis lucifugus (Little brown bat)
Target Names
SMIM12
Target Protein Sequence
MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVLSLKDKLEFAPKAVLNRNRPEKN
Uniprot No.

Target Background

Database Links
Protein Families
SMIM12 family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.