Recombinant Myxine glutinosa ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

MT-ATP6 is a core subunit of the F₀ domain of ATP synthase, facilitating proton translocation across the mitochondrial inner membrane to drive ATP synthesis .

Mechanistic Insights

  • Proton Channel: Forms part of the F₀ rotor-stator interface, enabling proton gradient utilization .

  • Pathological Relevance: Mutations in human MT-ATP6 are linked to neurodegenerative disorders (e.g., Leigh syndrome, NARP) due to impaired ATP production .

Biochemical Assays

  • SDS-PAGE Analysis: Used to verify purity and integrity .

  • Enzyme Activity Studies: Investigates ATP synthesis/hydrolysis mechanisms .

Disease Modeling

  • Mitochondrial Disorders: Structural homology with human MT-ATP6 allows studies on pathogenic variants (e.g., m.8993T>G) linked to ATPase dysfunction .

  • Yeast Models: Recombinant hagfish MT-ATP6 can inform studies on oxidative phosphorylation defects in engineered Saccharomyces cerevisiae strains .

Pathways and Interactions

MT-ATP6 participates in conserved mitochondrial pathways, as highlighted below :

PathwayRole of MT-ATP6Related Proteins
Oxidative PhosphorylationProton gradient coupling to ATP synthesisATP5A1, ATP5B, COX5B, NDUFAB1
Metabolic PathwaysEnergy metabolism regulationHADHB, PGK1, CYP19A1
Neurodegenerative DiseasesATP deficiency in neuronal cellsNDUFB8, COX7C, CDK5R1

Comparative Insights from Mutational Studies

Studies on human MT-ATP6 variants provide context for hagfish protein research:

  • m.8993T>G: Reduces ATP synthesis by 95% and increases mitochondrial membrane potential due to impaired proton channel function .

  • m.9185T>C: Disrupts proton translocation, lowering membrane potential and ATPase assembly .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve hagfish MT-ATP6’s role in F₀ assembly.

  • Therapeutic Screening: Use recombinant protein to test drugs targeting ATP synthase dysfunction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Myxine glutinosa (Atlantic hagfish)
Target Names
Target Protein Sequence
MMMSLFNTFESPYFLGFPLMIFIAILISLTMFIPDNNLLIKNQSSMLASTFLKTMTKEIF SPIKKSGHSWALLLMTTLMFIFLNNITGLLPYTFTVTSQLSLNMAMAIPLWLGTIIMGAT SQPSHSLAHLLPEGTPMTLAPFLIVIESISIIIRPLALGVRLTANITAGHLLIHLVSLAL INLTKSLPLLFLTFSVFILLLILELAVSFIQAYVFVMLVSLYLEENLI
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is produced by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of MT-ATP6 in ATP synthase?

MT-ATP6 encodes the subunit a of the F₀ region of ATP synthase (Complex V), a key component of the proton channel within the mitochondrial inner membrane. This subunit plays a critical role in proton translocation coupled to ATP synthesis. The MT-ATP6 protein functions within the membrane-bound F₀ domain, working with other subunits to facilitate the movement of protons across the mitochondrial inner membrane, which drives the rotary mechanism of ATP synthase .

In mitochondria, the ATP synthase complex uses the transmembrane proton motive force (pmf) generated by nutrient oxidation to power ATP synthesis. During this process, the central rotor turns approximately 150 times per second, coupling proton movement through the membrane to ATP production from ADP and phosphate . The MT-ATP6 protein specifically forms part of the proton channel and may play a direct role in the translocation of protons across the membrane .

How conserved is MT-ATP6 across species and what makes Myxine glutinosa MT-ATP6 of particular research interest?

MT-ATP6 is highly conserved across species due to its essential role in energy production. The mitochondrial genome, including MT-ATP6, shows strong evolutionary conservation, particularly in the proteins encoded in mitochondria . This conservation makes comparative studies between species valuable for understanding fundamental aspects of bioenergetics.

Myxine glutinosa (Atlantic hagfish) represents a phylogenetically ancient vertebrate lineage, providing insights into the evolutionary history of mitochondrial proteins. Studying MT-ATP6 in this species can reveal ancestral features of ATP synthase and evolutionary adaptations. Research with recombinant hagfish MT-ATP6 permits investigation of structure-function relationships in this evolutionarily distant organism compared to mammals, providing a broader understanding of ATP synthase evolution and adaptation.

What are the optimal storage and handling conditions for recombinant MT-ATP6 proteins?

For optimal preservation of recombinant Myxine glutinosa MT-ATP6:

Storage ParametersRecommendations
Temperature-20°C for extended storage; -80°C for long-term preservation
Buffer CompositionContains glycerol (typically 50%)
AliquotingRecommended to avoid freeze-thaw cycles
Working StorageStore working aliquots at 4°C for up to one week
Shelf Life6 months at -20°C/-80°C (liquid form); 12 months (lyophilized form)

Prior to use, briefly centrifuge the vial to dislodge any liquid in the container's cap. Repeated freezing and thawing is not recommended as it may compromise protein integrity . For reconstitution of lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of glycerol (final concentration 5-50%) for long-term storage .

How can researchers evaluate pathogenicity of MT-ATP6 variants using recombinant proteins?

Assessing pathogenicity of MT-ATP6 variants requires multiple complementary approaches:

  • Heterologous expression systems: Yeast models offer advantages for studying MT-ATP6 variants. The yeast atp6 gene can be replaced with mutated versions corresponding to human variants, allowing functional assessment in a genetically tractable system .

  • Functional assays: Key biochemical parameters to measure include:

    • ATP synthesis rate

    • ATP hydrolysis capacity

    • Mitochondrial membrane potential

    • Proton pumping efficiency

    • ATP synthase holoenzyme assembly

Research by Kabala et al. demonstrated that specific MT-ATP6 variants (m.8950G>A, m.9025G>A, m.9029A>G) significantly compromised ATP synthase function, while others (m.8843T>C, m.9016A>G, m.9058A>G, m.9139G>A, m.9160T>C) had minimal effects . This variance highlights the importance of functional testing to determine pathogenicity.

The experimental approach involves:

  • Introduction of mutations into yeast atp6 genes

  • Crossing with strains containing mitochondrial markers

  • Integration of variant genes into complete mitochondrial genome through recombination

  • Assessment of ATP production and other functional parameters

What methodologies are most effective for assessing ATP synthase activity using recombinant MT-ATP6?

Multiple complementary methodologies should be employed:

MethodologyMeasurementTechnical Considerations
ATP Synthesis AssayDirect measurement of ATP production rateUses substrates like malate or succinate; may show substrate-dependent differences
ATP Hydrolysis AssayMeasures ATP breakdown capacityCommonly used but may not reflect synthesis capacity
Membrane Potential AnalysisAssesses proton gradient maintenanceCan be increased or decreased depending on mutation type
Oligomycin SensitivityTests ATP synthase inhibition responseAltered response indicates structural changes in complex
Complex Assembly AnalysisEvaluates formation of complete ATP synthaseSome mutations impair holoenzyme assembly

It's crucial to note that no single biochemical marker is universally affected across all pathogenic MT-ATP6 variants. For instance, some variants like m.8993T>G typically result in increased mitochondrial membrane potential (suggesting impaired proton flow through the pore), while others like m.9185T>C cause decreased membrane potential (indicating unregulated proton release) .

How can structure-function relationship studies be designed using recombinant MT-ATP6?

Structure-function studies with MT-ATP6 can employ several strategic approaches:

  • Comparative mutagenesis: Introducing specific mutations in conserved residues and examining their impact on function. For example, studies have investigated variants affecting conserved residues in MT-ATP6 including p.I106T, p.V142I, p.I164V, p.G167S, p.H168R, p.T178A, p.A205T, and p.Y212H .

  • Proton channel analysis: Since MT-ATP6 forms part of the proton channel, mutations can affect proton movement. Experimental designs should measure:

    • Proton translocation efficiency

    • Coupling between proton flow and ATP synthesis

    • Membrane potential maintenance

  • Interface mapping: MT-ATP6 interacts with other subunits of ATP synthase. Mutations at interaction interfaces can reveal critical contact points for assembly or function .

  • Evolutionary conservation analysis: Comparing sequences across species helps identify functionally critical regions. Residues conserved between Myxine glutinosa and humans likely serve essential functions .

When designing these experiments, researchers should consider that mutations in different regions of MT-ATP6 can have distinct mechanistic effects. For example, some mutations impair proton pumping efficiency while maintaining normal holocomplex formation, while others affect both assembly and function .

What expression systems are optimal for producing functional recombinant MT-ATP6?

Multiple expression systems can be used for recombinant MT-ATP6 production:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, challenging for membrane proteinsBasic binding studies, antibody production
YeastEukaryotic PTMs, good for membrane proteinsLower yield than bacteria, longer production timeFunctional studies, especially for mitochondrial proteins
BaculovirusHigher-order eukaryotic PTMs, good for complex proteinsMore expensive, technically demandingComplex functional studies
Mammalian cellNative-like PTMs and foldingLowest yield, highest costMost physiologically relevant studies

When selecting an expression system, consider:

  • The experimental question being addressed

  • Required protein modifications and folding

  • Membrane integration requirements

  • Budget and timeline constraints

What controls should be included in experiments using recombinant MT-ATP6?

Rigorous controls are essential for experiments with recombinant MT-ATP6:

  • Protein quality controls:

    • SDS-PAGE with western blotting to confirm size and integrity

    • Mass spectrometry to verify sequence

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate stability

  • Functional controls:

    • Wild-type MT-ATP6 as baseline comparison

    • Known pathogenic variants as positive controls (e.g., m.8993T>G)

    • Non-pathogenic polymorphisms as negative controls

    • ATP synthase inhibitors (oligomycin) to confirm specificity of activity measurements

  • System-specific controls:

    • Empty vector/expression system controls

    • Heteroplasmy level validation when studying mutations (since heteroplasmy threshold for MT-ATP6 variants appears to be quite high)

    • Substrate controls when measuring ATP synthesis (comparing malate vs. succinate as substrates can reveal different defects)

Studies should examine multiple biochemical parameters simultaneously, as no single feature is universally affected across all pathogenic MT-ATP6 variants .

How can recombinant MT-ATP6 contribute to understanding mitochondrial diseases?

Recombinant MT-ATP6 serves as a valuable tool for investigating mitochondrial diseases through several approaches:

  • Variant pathogenicity assessment: Validating the pathogenicity of MT-ATP6 variants remains challenging due to limited clinical functional assays . Recombinant proteins allow systematic evaluation of:

    • ATP synthesis capacity

    • ATP hydrolysis activity

    • Membrane potential effects

    • Complex assembly

    • Oligomycin sensitivity

  • Heteroplasmy threshold determination: Studies show that symptomatic subjects with MT-ATP6 variants have significantly higher heteroplasmy load (p=2.2×10^-16) . Recombinant proteins can help establish functional thresholds for different variants.

  • Mechanistic insights: Different MT-ATP6 mutations cause distinct biochemical defects. For instance:

    • m.8993T>G typically increases mitochondrial membrane potential

    • m.9185T>C typically decreases mitochondrial membrane potential

    These differences suggest variable mechanisms of pathogenicity that can be explored with recombinant proteins.

  • Therapeutic development: Recombinant MT-ATP6 can be used to screen compounds that might modulate ATP synthase function or stabilize mutant proteins, potentially identifying therapeutic approaches for mitochondrial diseases.

What insights can hagfish MT-ATP6 provide for evolutionary adaptations in bioenergetics?

Myxine glutinosa (Atlantic hagfish) represents an ancient vertebrate lineage that diverged approximately 550 million years ago. Studying its MT-ATP6 offers valuable evolutionary perspectives:

  • Ancestral features: Hagfish MT-ATP6 may retain ancestral features that were modified in later-diverging vertebrates, providing insights into the original functions and structural elements of ATP synthase.

  • Environmental adaptations: Hagfish have adapted to extreme conditions including low oxygen environments and high pressure. Their ATP synthase may show adaptations for energy production under these challenging conditions.

  • Comparative functionality: Comparing the functional properties of hagfish MT-ATP6 with those of mammals can reveal which aspects of ATP synthase function have been conserved versus modified throughout vertebrate evolution.

  • Structure-function evolution: Analysis of conserved residues between hagfish and human MT-ATP6 can identify the most critical amino acids for function, potentially clarifying which residues should be prioritized when assessing human variants of uncertain significance.

Such evolutionary studies contribute to our fundamental understanding of mitochondrial bioenergetics across vertebrate lineages and may provide unexpected insights for human disease research.

What are common challenges in working with recombinant MT-ATP6 and how can they be addressed?

Researchers working with recombinant MT-ATP6 face several technical challenges:

ChallengePotential Solution
Membrane protein solubilityUse appropriate detergents or lipid nanodisc systems for stabilization
Maintaining native conformationConsider mild solubilization conditions and rapid purification
Functional reconstitutionIncorporate into proteoliposomes with defined lipid composition
Association with other subunitsCo-express with interacting partners or reconstitute with purified components
Heteroplasmy simulationCreate defined mixtures of wild-type and variant proteins
Activity measurement limitationsUse multiple complementary assays (synthesis, hydrolysis, membrane potential)

How can inconsistencies in experimental results with MT-ATP6 variants be reconciled?

Experimental variations with MT-ATP6 variants are common and may be reconciled through:

  • Standardized protocols: Developing consistent methodologies for ATP synthase functional assessment. Currently, there is significant variation in approaches, making cross-study comparisons difficult .

  • Multi-parameter assessment: No single biochemical marker is universally affected across all pathogenic MT-ATP6 variants . A comprehensive panel including ATP synthesis, ATP hydrolysis, membrane potential, and complex assembly should be evaluated.

  • Heteroplasmy considerations: Extensive overlap exists in heteroplasmy levels between symptomatic and asymptomatic carriers of MT-ATP6 variants . Careful control of heteroplasmy levels in experimental systems is essential.

  • Model system differences: Results may vary between yeast models, patient-derived cells, and recombinant protein systems. These differences should be acknowledged and integrated into a comprehensive understanding rather than viewed as contradictory.

  • Contextual factors: The nuclear genetic background, mitochondrial haplotype, and environmental factors can all influence the expression of MT-ATP6 variants. These variables should be considered when interpreting seemingly discrepant results.

By addressing these factors, researchers can develop a more nuanced understanding of how MT-ATP6 variants affect ATP synthase function and contribute to disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.