Recombinant Myxine glutinosa Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase subunit 2 (MT-CO2) is a protein component of the cytochrome c oxidase enzyme complex, which is essential for cellular respiration in mitochondria. Myxine glutinosa, also known as the Atlantic hagfish, is a unique marine vertebrate that maintains its body fluids isoosmotic to seawater . Research involving recombinant MT-CO2 in Myxine glutinosa may focus on understanding the physiological adaptations of this species or exploring the functional characteristics of its proteins.

Background on Myxine glutinosa

Myxine glutinosa belongs to the cyclostomes and stands out as the only vertebrate with body fluids that match the osmotic concentration of seawater, due to high levels of sodium and chloride . Their kidneys do not reabsorb fluid or sodium from the glomerular filtrate, but they do reabsorb calcium, glucose, and magnesium while excreting potassium and phosphate .

Myxine glutinosa serves as a bioindicator species in studies on the effects of dumped chemical warfare agents .

Role of MT-CO2 in Cytochrome c Oxidase

Cytochrome c oxidase (Complex IV) is a critical enzyme in the electron transport chain, catalyzing the final step in mitochondrial oxidative phosphorylation. This process generates ATP, the main energy currency of the cell. MT-CO2 is a key subunit of this enzyme, involved in electron transfer and proton pumping.

Research Significance

Research on recombinant Myxine glutinosa MT-CO2 could provide insights into:

Research Findings

Because information is limited regarding research findings specific to recombinant Myxine glutinosa MT-CO2, data from related studies are presented to provide a broader context.

ElectrolyteSeawater (Maine)PlasmaUrine
Osmolality (m-osmol/kg)898 ± 65980 ± 1041053 ± 99
Na+ (mM)424 ± 31439 ± 29462 ± 22
K+ (mM)8.9 ± 0.95.9 ± 0.98.6 ± 4.6

Table adapted from Renal electrolyte and fluid excretion in the Atlantic hagfish (Myxine glutinosa) .

CompoundConcentrations Tested (µM) (GI50 Concentration in the Tumor Cell Lines)% Cell Growth in MCF-12A Cell Line (Relative to the Control)
2e12.5688.62 ± 4.04
2f8.73117.73 ± 3.22
2h4.6782.13 ± 4.78

Table adapted from Synthesis of Novel Methyl 3-(hetero)arylthieno[3,2-b]pyridine-2-carboxylates and Antitumor Activity Evaluation: Studies In Vitro and In Ovo Grafts of Chick Chorioallantoic Membrane (CAM) with a Triple Negative Breast Cancer Cell Line .

Methodological Considerations

To study recombinant MT-CO2, researchers might employ the following methods:

  • Gene cloning and expression Cloning the MT-CO2 gene from Myxine glutinosa, followed by expression in a suitable host organism (e.g., E. coli, yeast, or mammalian cells).

  • Protein purification Isolating the recombinant protein using affinity chromatography or other purification techniques.

  • Spectroscopic characterization Using UV-Vis spectroscopy, electron paramagnetic resonance (EPR), and other methods to study the protein's structural and redox properties.

  • Enzyme kinetics assays Measuring the activity of the recombinant enzyme using cytochrome c oxidation assays.

  • Structural studies Employing X-ray crystallography or cryo-EM to determine the three-dimensional structure of the protein.

Potential Applications

  • Drug development Understanding the structure and function of MT-CO2 could aid in developing drugs targeting mitochondrial dysfunction.

  • Bioremediation Exploring the potential of MT-CO2 in bioremediation processes.

  • Biomarker studies Investigating MT-CO2 as a potential biomarker for environmental stress in marine organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Myxine glutinosa (Atlantic hagfish)
Target Names
Target Protein Sequence
MANHLQFNFQDATSPLMQELVKFHDHSLTILFFISALILYVLMMTSLSKLTNKNILDSQE IEMVWTVIPAFILIMLALPSIQILYLMDEIASPDITIKTVGHQWYWTYEFSDLSKESEIE SYMLPTADLQNGDFRLLEVDNRISVPMDSKIRMLITSEDVLHAWTLPSMGIKVDAVPGRL NQVTFSSSLPGLFFGQCSEICGANHSFMPIAMEVIPLKTFESWIIKLSL
Uniprot No.

Target Background

Function

Recombinant Myxine glutinosa Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) composed of heme A3 and CuB. The BNC reduces molecular oxygen to 2 water molecules, utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and what is its role in cellular metabolism?

Cytochrome c oxidase subunit 2 (MT-CO2) functions as a critical component of the mitochondrial respiratory chain, serving as part of the terminal enzyme complex in cellular respiration in both eukaryotes and prokaryotes. The oxidized form of cytochrome c can accept electrons from the cytochrome c1 subunit of cytochrome reductase and subsequently transfer these electrons to the cytochrome oxidase complex, completing the final step in mitochondrial electron transport . This process is fundamental to energy production in aerobic organisms, making MT-CO2 essential for cellular metabolism and function.

How does Myxine glutinosa MT-CO2 differ structurally and functionally from other species?

Myxine glutinosa (Atlantic hagfish) MT-CO2 consists of 229 amino acids in its full-length form . While maintaining the core functional domains characteristic of cytochrome c oxidase proteins, comparative analyses reveal that hagfish MT-CO2 exhibits distinct structural features that reflect its evolutionary position. Research indicates that while the protein shares conserved regions with other vertebrates, particularly around the copper-binding sites and electron transfer pathways, it also displays unique sequences that may influence its catalytic efficiency and stability under different physiological conditions . These differences are particularly evident in the transmembrane domains and in regions involved in protein-protein interactions.

What are the standard expression systems used for recombinant production of MT-CO2?

Recombinant Myxine glutinosa MT-CO2 is typically expressed in Escherichia coli expression systems, which offer several advantages for protein production . The standard protocol involves cloning the full-length coding sequence (amino acids 1-229) into an expression vector containing an N-terminal His-tag for purification purposes. This approach yields protein with greater than 90% purity as determined by SDS-PAGE analysis . Alternative expression systems, including yeast and insect cells, may be employed when post-translational modifications are required, though these are less commonly reported in the literature for hagfish MT-CO2.

What are the optimal conditions for solubilizing and reconstituting lyophilized MT-CO2?

For optimal reconstitution of lyophilized MT-CO2, the following protocol is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) to enhance stability

  • Aliquot immediately for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles

This approach maximizes protein stability while minimizing denaturation. The Tris/PBS-based buffer at pH 8.0 with 6% trehalose in the storage formulation helps maintain protein structure during the reconstitution process .

How can researchers verify the functional activity of recombinant MT-CO2 after purification?

Verification of MT-CO2 functional activity can be accomplished through multiple complementary approaches:

  • Spectroscopic analysis: Monitor the characteristic absorption spectrum of the heme group (Soret band at ~410-420 nm and α/β bands at ~530-560 nm)

  • Oxygen consumption assays: Measure oxygen reduction activity using oxygen electrodes

  • Electron transfer assays: Assess the ability to accept electrons from cytochrome c using stopped-flow spectroscopy

  • Binding studies: Evaluate interaction with known partners using surface plasmon resonance or isothermal titration calorimetry

Additionally, comparing enzymatic parameters (Km, Vmax, catalytic efficiency) with native protein provides a robust assessment of functional integrity. Circular dichroism can also confirm proper secondary structure formation, which is crucial for activity.

What methodological approaches are most effective for structural analysis of MT-CO2?

Structural analysis of MT-CO2 relies on multiple complementary techniques:

  • Homology modeling: When crystallographic data is unavailable, software such as MODELLER can generate reliable 3D structural models based on homologous proteins with known structures

  • X-ray crystallography: Though challenging, this remains the gold standard for high-resolution structural determination

  • Cryo-electron microscopy: Increasingly used for membrane proteins like MT-CO2

  • Molecular dynamics simulations: Essential for understanding conformational flexibility and substrate interactions

For hagfish MT-CO2 specifically, homology modeling has proven effective, with models validated through Ramachandran plot analysis, PROCHECK evaluation, and comparison with experimentally determined structures of homologous proteins from other species .

How can MT-CO2 be utilized in environmental biomonitoring studies?

Atlantic hagfish MT-CO2 has emerged as a valuable biomarker in environmental monitoring, particularly for assessing the impact of chemical warfare agents (CWAs) and other contaminants in marine ecosystems. The protein's activity and expression levels respond measurably to environmental stressors, making it an effective indicator of ecosystem health . In field studies, significant differences in oxidative stress responses and enzyme activities (including cytochrome c oxidase) have been observed between hagfish collected from contaminated sites versus reference locations . This approach provides a molecular-level assessment of environmental impact that complements traditional chemical analysis.

To implement this methodology:

  • Collect tissue samples (typically gill or liver) from hagfish at test and reference sites

  • Extract and quantify MT-CO2 using standardized protocols

  • Assess protein activity, expression levels, and post-translational modifications

  • Correlate findings with environmental parameters and contaminant concentrations

What insights can comparative analysis of MT-CO2 across species provide for evolutionary studies?

Comparative analysis of MT-CO2 across species offers profound insights into respiratory chain evolution and adaptation. Research has revealed that hagfish MT-CO2 shares approximately 63-68% sequence homology with other vertebrates , positioning it as an important link in understanding the evolution of mitochondrial respiratory complexes.

Key evolutionary insights include:

  • Conservation of functional domains, particularly the copper-binding sites involving Cys and His residues

  • Preservation of acidic amino acid residues (Asp and Glu) involved in cytochrome c interactions

  • Conservation of aromatic regions (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) implicated in electron transfer

These comparative studies help elucidate the molecular basis of functional adaptation across diverse environments and phylogenetic lineages.

How does MT-CO2 interact with potential inhibitors and what implications does this have for research?

Molecular docking studies reveal that MT-CO2 interacts with various natural compounds and pharmaceutical agents through specific binding pockets, primarily involving hydrophobic interactions and hydrogen bonding . Computational analyses have identified several key interaction regions that could serve as targets for selective inhibition or modulation.

These findings have significant implications for:

  • Toxicological research: Understanding how environmental toxins may disrupt respiratory function

  • Pharmacological studies: Developing compounds that selectively target specific cytochrome c oxidase variants

  • Evolutionary biochemistry: Exploring how binding site differences affect substrate specificity across species

When conducting such studies, researchers should employ multiple docking algorithms and validate in silico predictions with experimental binding assays to ensure reliability.

What are the major challenges in maintaining stability of recombinant MT-CO2 during experimental procedures?

Recombinant MT-CO2 stability presents several challenges during experimental work:

  • Aggregation propensity: The hydrophobic transmembrane domains can lead to protein aggregation

  • Heme dissociation: The critical heme cofactor may dissociate during purification or storage

  • Oxidative damage: The protein is susceptible to oxidative modification under ambient conditions

  • Freeze-thaw degradation: Repeated freeze-thaw cycles significantly reduce activity

To address these challenges:

  • Maintain proper buffer conditions (Tris/PBS-based buffer, pH 8.0)

  • Include stabilizing agents like trehalose (6%) in storage formulations

  • Add glycerol (5-50%) before aliquoting

  • Store working aliquots at 4°C for short-term use (up to one week)

  • Avoid repeated freeze-thaw cycles by creating single-use aliquots

How can researchers distinguish between sequence variations and post-translational modifications when analyzing MT-CO2?

Distinguishing between genetic sequence variations and post-translational modifications requires a multi-faceted analytical approach:

  • High-resolution mass spectrometry: Enables precise mass determination to identify both sequence variations and modifications

  • Site-directed mutagenesis: Systematically alter potential modification sites to determine functional impact

  • Proteomic workflows: Combine enzymatic digestion with LC-MS/MS for comprehensive peptide mapping

  • Comparative genomics: Align sequences across multiple Myxine glutinosa specimens to identify conserved versus variable regions

For hagfish MT-CO2 specifically, researchers should pay particular attention to cysteine residues involved in heme binding and potential phosphorylation sites that may regulate activity under different physiological conditions.

How does hagfish MT-CO2 compare structurally with homologs from other species?

SpeciesAmino Acid LengthSequence Homology to HagfishKey Structural DifferencesFunctional Implications
Myxine glutinosa (Atlantic hagfish)229100% (reference)Contains three potential transmembrane helicesBase comparison
Homo sapiensVariableModerateTwo transmembrane helices; different signal sequenceAdapted for higher metabolic rate
Rhodobacter sphaeroidesVariableLow-moderateContains third transmembrane helix that may function as part of signal sequenceBacterial adaptation
Paracoccus denitrificansVariableLow-moderate (68% to R. sphaeroides)Similar to R. sphaeroidesBacterial adaptation
BovineVariableLow-moderate (63% to R. sphaeroides)Two transmembrane helicesMammalian adaptation

Note: All species retain conserved copper-binding sites involving Cys and His residues, acidic amino acid residues for cytochrome c interactions, and aromatic regions for electron transfer .

What methodological approaches should be employed when analyzing contradictory experimental results with MT-CO2?

When faced with contradictory results in MT-CO2 research, implement this systematic troubleshooting approach:

  • Verify protein integrity: Confirm proper folding and cofactor incorporation using spectroscopic methods

  • Evaluate experimental conditions: Systematically test buffer composition, pH, temperature, and ionic strength effects

  • Consider post-translational modifications: Assess whether different preparation methods affect modification status

  • Examine experimental artifacts: Rule out interference from tags, contaminants, or aggregation

  • Employ orthogonal techniques: Validate findings using complementary methodological approaches

For quantitative discrepancies, statistical meta-analysis of pooled data can help identify outliers and establish confidence intervals for experimental parameters.

How might advances in protein engineering be applied to enhance the utility of recombinant MT-CO2 for research?

Protein engineering approaches offer significant potential for enhancing MT-CO2 utility:

  • Stability engineering: Introduce strategic mutations to improve thermostability and resistance to oxidative damage

  • Affinity tag optimization: Develop constructs with removable tags that minimize functional interference

  • Fluorescent protein fusions: Create chimeric proteins for real-time monitoring of expression and localization

  • Activity modulation: Engineer variants with altered catalytic properties for mechanistic studies

  • Solubility enhancement: Modify hydrophobic regions to improve expression yields and reduce aggregation

These approaches could significantly expand MT-CO2's application in biomonitoring, structural studies, and as a model system for understanding respiratory chain function.

What emerging technologies will likely advance our understanding of MT-CO2 structure-function relationships?

Several cutting-edge technologies are poised to revolutionize MT-CO2 research:

  • Cryo-EM advances: Improved resolution for membrane protein structures without crystallization

  • AlphaFold and deep learning: Enhanced structural prediction accuracy for regions lacking homology

  • Single-molecule techniques: Direct observation of conformational changes during catalytic cycles

  • Advanced spectroscopies: Time-resolved methods to capture transient catalytic intermediates

  • Genome editing: CRISPR-based approaches for precise in vivo modification of MT-CO2 genes

These technologies will facilitate more accurate structural models, deeper insights into electron transfer mechanisms, and better understanding of MT-CO2's role in cellular respiration across diverse species and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.