Recombinant Myxococcus xanthus NADH-quinone oxidoreductase subunit K (nuoK)

What is the molecular structure of Myxococcus xanthus nuoK?

Myxococcus xanthus nuoK is a relatively small membrane protein consisting of 100 amino acids. The protein has a characteristic hydrophobic profile typical of membrane-embedded subunits with multiple transmembrane domains. Based on homology with other bacterial nuoK proteins, its structure includes:

• Predominantly alpha-helical transmembrane segments

• Highly hydrophobic amino acid composition

• Conserved residues crucial for proton translocation

• Specific amino acid sequence: MVPITYYLLLAAALFCMGMFGVLVRRNALVVFMSVELMLNAANLTFVAFARMRGDNLGHVSAFFVIAVAAAEAAIGLAIVIAVFRSRGSILLEDLRTMKH

The protein's tertiary structure enables its integration into the membrane domain of the larger NADH dehydrogenase complex, where it interacts with other membrane subunits to form functional proton channels.

What expression systems are recommended for producing recombinant Myxococcus xanthus nuoK?

For optimal expression of recombinant M. xanthus nuoK, researchers should consider the following methodological approaches:

• E. coli expression systems:

  • BL21(DE3) strains with T7 promoter-based vectors for controlled expression

  • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Codon-optimized sequences to account for codon usage differences between M. xanthus and E. coli

• Expression conditions:

  • Induction at lower temperatures (16-20°C) to facilitate proper membrane protein folding

  • Use of mild inducers like 0.1-0.5 mM IPTG to prevent formation of inclusion bodies

  • Extended expression periods (16-24 hours) at reduced temperatures

  • Addition of membrane-stabilizing components like glycerol (5-10%) to the growth medium

• Fusion tags:

  • N-terminal His-tag for purification (similar to the approach used for nuoA)

  • Consider using fusion partners like MBP (maltose-binding protein) to enhance solubility

  • Inclusion of TEV or PreScission protease cleavage sites for tag removal if needed for functional studies

Experimental evidence indicates that E. coli has been successfully used to express other related M. xanthus membrane proteins such as nuoA , suggesting comparable approaches would be suitable for nuoK.

What are the most effective purification strategies for recombinant nuoK?

Purification of recombinant nuoK requires specialized techniques for membrane proteins:

• Membrane fraction isolation:

  • Cell disruption using sonication or high-pressure homogenization in buffer containing stabilizers (glycerol, salt)

  • Differential centrifugation to separate membrane fractions (typically 100,000 × g ultracentrifugation)

  • Careful washing of membrane pellets to remove peripheral proteins

• Solubilization optimization:

  • Screen multiple detergents including:

    Detergent	Concentration Range	Comments
    n-Dodecyl β-D-maltoside (DDM)	0.5-2%	Mild detergent, good for retaining function
    n-Octyl glucoside	0.5-1.5%	Easily dialyzable
    Digitonin	0.5-1%	Very mild, preserves protein-protein interactions
    LMNG	0.01-0.1%	Stabilizes membrane proteins

  • Incubate with detergent at 4°C with gentle rotation for 1-2 hours

• Affinity chromatography:

  • IMAC (Ni-NTA) purification for His-tagged proteins

  • Careful optimization of imidazole concentration in wash buffers (10-40 mM) to minimize non-specific binding

  • Elution with 250-500 mM imidazole containing appropriate detergent at CMC concentrations

• Further purification:

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Use of stabilizing additives in all buffers (glycerol, salt, detergent)

When working with nuoK, it's advisable to monitor protein stability throughout purification and store in conditions similar to those used for nuoA (Tris/PBS-based buffer with 6% trehalose at pH 8.0) .

How can researchers verify the functional integrity of purified recombinant nuoK?

Verification of functional integrity for purified nuoK involves multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism spectroscopy to confirm alpha-helical content characteristic of membrane proteins

  • Thermal stability assays using differential scanning fluorimetry with appropriate membrane mimetics

  • Limited proteolysis to assess proper folding (correctly folded proteins typically show resistance to proteolysis at specific sites)

• Reconstitution methods:

  • Incorporation into proteoliposomes using polar lipid extracts from M. xanthus or E. coli

  • Validation of proper orientation using selective proteolysis or fluorescent labeling

  • Measurement of proton translocation activity using pH-sensitive fluorescent dyes

• Functional assays:

  • NADH oxidation assays in reconstituted systems

  • Measurement of proton pumping efficiency using pH indicators or potentiometric methods

  • Electron transfer activity measurement using artificial electron acceptors like ferricyanide

• Interaction verification:

  • Pull-down assays to confirm binding to other NADH dehydrogenase complex subunits

  • Blue native PAGE to assess complex formation in mild detergent conditions

  • Crosslinking studies to identify neighboring subunits in the complex

These approaches will help ensure that the recombinant nuoK maintains its native-like properties after the expression and purification process.

How can nuoK be used to study the bioenergetics of Myxococcus xanthus predation?

Investigating nuoK's role in M. xanthus predation bioenergetics requires sophisticated experimental designs:

• Conditional expression systems:

  • Development of inducible or repressible nuoK expression systems in M. xanthus

  • Creation of nuoK variants with altered proton pumping efficiency to modulate energy production

  • Temporal control of nuoK expression to study energy requirements during different predation phases

• Metabolic analysis during predation:

  • Real-time monitoring of ATP/ADP ratios in wild-type versus nuoK-modified strains during predation

  • Oxygen consumption measurements to assess respiratory chain activity during prey encounter and lysis

  • Metabolomic profiling to identify energy-dependent metabolic shifts during predation

• Integration with predation mechanisms:

  • Analysis of how energy availability affects production of predatory secondary metabolites like myxovirescin A and myxoprincomide

  • Investigation of energy-dependent formation of outer membrane vesicles (OMVs) that deliver lytic factors to prey

  • Correlation between respiratory chain activity and operation of specialized secretion systems involved in predation

• Comparative bioenergetics across prey types:

  • Assessment of energy requirements when predating different prey bacteria (Gram-positive vs. Gram-negative)

  • Analysis of how energy allocation shifts when faced with resistant prey species

This research direction would provide crucial insights into the energetic costs of bacterial predation and how M. xanthus manages its energy budget during this complex process.

What techniques can be used to investigate nuoK interactions with other respiratory complex components?

Investigating nuoK's interactions with other respiratory complex components requires specialized approaches for membrane protein complexes:

• Crosslinking coupled with mass spectrometry:

  • In vivo crosslinking using membrane-permeable reagents

  • Site-specific incorporation of photo-activatable crosslinkers at predicted interaction interfaces

  • Mass spectrometric identification of crosslinked peptides to map interaction sites

• Cryo-electron microscopy:

  • Single-particle analysis of purified respiratory complexes containing nuoK

  • Subtomogram averaging of membrane regions containing respiratory complexes

  • Comparison of structures with and without nuoK to identify structural contributions

• Co-purification strategies:

  • Tandem affinity purification using tagged nuoK as bait

  • Quantitative proteomics to identify interaction partners under different physiological conditions

  • Blue native electrophoresis combined with second-dimension SDS-PAGE to resolve complex components

• Computational approaches:

  • Molecular dynamics simulations of nuoK within membrane environments

  • Protein-protein docking to predict interaction interfaces with other complex components

  • Evolutionary coupling analysis to identify co-evolving residues that may indicate interaction points

• Functional interaction studies:

  Technique	Information Obtained	Advantages
  FRET analysis	Real-time protein interactions	Works in living cells
  Genetic suppressor screens	Functional interactions	Identifies physiologically relevant partners
  Complementation assays	Functional domains	Tests specific interaction hypotheses
  Split-reporter assays	Direct protein interactions	High sensitivity for transient interactions

These approaches would help elucidate how nuoK contributes to the structural and functional integrity of the NADH dehydrogenase complex in M. xanthus.

How does nuoK compare structurally and functionally across different Myxobacteria species?

Understanding nuoK's evolutionary and functional conservation across Myxobacteria provides valuable insights into respiratory adaptation:

• Comparative sequence analysis:

  • Multiple sequence alignment of nuoK from diverse Myxobacteria including predatory species like Corallococcus and non-predatory relatives

  • Identification of conserved motifs potentially critical for function versus variable regions that might reflect species-specific adaptations

  • Calculation of selection pressures (dN/dS ratios) acting on different domains to identify functionally constrained regions

• Structural comparisons:

  • Homology modeling of nuoK from different species based on available structures

  • Analysis of predicted transmembrane topologies across the myxobacterial family

  • Comparison of surface properties that might influence interactions with other complex components

• Heterologous expression studies:

  • Cross-species complementation experiments to test functional conservation

  • Expression of nuoK variants from different species in M. xanthus nuoK deletion strains

  • Analysis of respiratory efficiency with heterologous nuoK proteins

• Correlation with predatory efficiency:

  • Investigation of whether nuoK sequence variations correlate with predatory capabilities

  • Assessment of whether respiratory efficiency differences reflect ecological niches or predatory strategies

  • Functional testing of whether nuoK variants from highly predatory species confer enhanced predation when expressed in less predatory relatives

This research direction would reveal how respiratory chain components like nuoK have evolved in concert with the predatory lifestyle of Myxobacteria.

What are the common pitfalls when expressing recombinant nuoK and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant nuoK:

• Poor expression levels:

  • Solution: Optimize codon usage for expression host and use stronger ribosome binding sites

  • Solution: Test different promoter systems (T7, tac, arabinose-inducible)

  • Solution: Explore expression in specialized E. coli strains like Lemo21(DE3) that allow tunable expression

• Inclusion body formation:

  • Solution: Reduce induction temperature to 16-18°C and extend expression time

  • Solution: Decrease inducer concentration to promote slower, more controlled expression

  • Solution: Co-express molecular chaperones like GroEL/ES or DnaK/J systems

  • Solution: Use fusion partners known to enhance solubility (MBP, SUMO, NusA)

• Protein misfolding:

  • Solution: Include membrane-mimetic environments during extraction (mild detergents, amphipols)

  • Solution: Supplement growth media with specific phospholipids

  • Solution: Co-express proteins known to assist membrane protein folding

• Proteolytic degradation:

  • Solution: Add protease inhibitors during all purification steps

  • Solution: Use protease-deficient expression strains

  • Solution: Optimize buffer conditions (pH, salt concentration) to minimize proteolysis

  • Solution: Perform purification steps at 4°C and minimize sample handling time

• Low purification yields:

  • Solution: Optimize detergent type and concentration for efficient solubilization without denaturation

  • Solution: Incorporate stabilizing agents like glycerol (5-10%) and trehalose (6%)

  • Solution: Use larger culture volumes to compensate for lower per-cell yields

Addressing these challenges requires systematic optimization and may necessitate combining multiple approaches tailored to the specific expression system being used.

How can researchers distinguish between functional and non-functional recombinant nuoK preparations?

Distinguishing functional from non-functional nuoK preparations is critical for reliable research outcomes:

• Biophysical characterization:

  • Thermal denaturation profiles: Functional preparations typically show cooperative unfolding transitions

  • Size-exclusion chromatography: Monodisperse peaks suggest properly folded protein, while aggregation peaks indicate non-functional material

  • Dynamic light scattering: Functional preparations show consistent particle size distribution

• Structural integrity markers:

  • Circular dichroism to confirm expected secondary structure content

  • Intrinsic tryptophan fluorescence to assess tertiary structure integrity

  • Resistance to limited proteolysis compared to denatured controls

• Functional comparisons:

  Parameter	Functional Preparation	Non-functional Preparation
  Detergent resistance	Stable in multiple detergents	Precipitates easily
  Lipid binding	Selective interaction with specific lipids	Non-specific binding or no binding
  Complex formation	Forms higher-order assemblies with partner proteins	Fails to associate properly
  Activity measurements	Consistent proton translocation activity	No measurable activity
  Inhibitor sensitivity	Responds to specific inhibitors	No response to inhibitors

• Reconstitution testing:

  • Successful incorporation into liposomes or nanodiscs

  • Appropriate orientation in membrane mimetics

  • Restoration of activity in reconstituted systems

• Control comparisons:

  • Side-by-side testing with established functional preparations

  • Comparison with intentionally denatured samples as negative controls

  • Benchmarking against literature values for similar proteins

These approaches collectively provide a robust assessment of nuoK functionality, ensuring that subsequent experiments are conducted with properly folded, active protein.

What controls should be included when studying nuoK in the context of Myxococcus xanthus predation?

Rigorous control experiments are essential when investigating nuoK's role in M. xanthus predation:

These comprehensive controls help ensure that observed phenotypes are specifically attributable to nuoK's function rather than secondary effects or experimental artifacts.

How might nuoK be involved in the adaptation of Myxococcus xanthus to different prey types?

Recent research suggests that respiratory chain components may play unexpected roles in bacterial predation adaptability:

• Energy allocation hypotheses:

  • Different prey types may require varied energy investments for effective predation

  • NuoK activity might be modulated depending on prey resistance mechanisms

  • Respiratory efficiency could influence the production of prey-specific predatory compounds like myxoprincomide

• Metabolic integration pathways:

  • NuoK function potentially links the sensing of prey-derived metabolites to energy production

  • Respiratory chain activity may adjust to optimize utilization of nutrients released from different prey species

  • Energy generation through nuoK-containing complexes might coordinate with the expression of predatory factors via global metabolic regulators

• Experimental approaches to investigate this relationship:

  • Transcriptomic analysis of nuoK expression when M. xanthus encounters different prey bacteria

  • Metabolic flux analysis comparing energy distribution during predation of various prey

  • Creation of nuoK variants with altered activity to test prey-specific predation efficiency

  • Correlation analysis between respiratory chain activity and prey-specific transcriptional responses

• Predatory versatility connection:

  • The unusually broad prey range of M. xanthus may partly depend on flexible energy management

  • NuoK function could contribute to the bacterium's ability to deploy different predatory strategies, from antibiotic production to outer membrane vesicle delivery

  • Energy efficiency through optimal respiratory chain function might determine competitive success in complex microbial communities

This research direction could reveal unexpected connections between basic energy metabolism and sophisticated predatory adaptations in M. xanthus.

What role might nuoK play in the developmental life cycle of Myxococcus xanthus?

Beyond its role in energy metabolism, nuoK may contribute to the remarkable developmental transitions in M. xanthus:

• Energy-dependent developmental checkpoints:

  • The transition from predatory swarming to fruiting body formation requires precise energy sensing

  • NuoK activity could provide metabolic signals that influence developmental gene expression

  • Energy status sensed through respiratory chain function might determine commitment to sporulation

• Spatial organization requirements:

  • Fruiting body formation involves complex cellular movements and aggregation

  • Energy supplied through respiratory complexes containing nuoK powers the motility systems essential for development

  • Local energy availability might create microenvironments that direct cellular differentiation

• Research approaches to explore this connection:

  • Time-course analysis of nuoK expression during developmental progression

  • Development assays with nuoK mutants under varying energy availability conditions

  • Single-cell imaging of energy status markers during developmental transitions

  • Correlation between respiratory chain activity and developmental signaling pathways

• Integration with specialized metabolism:

  • Development in M. xanthus involves production of specific signaling molecules

  • NuoK-dependent energy production may regulate secondary metabolite biosynthesis during development

  • The balance between energy conservation and specialized metabolite production could influence developmental outcomes

This research direction could uncover how fundamental energy-generating components like nuoK are integrated into the complex developmental programs of M. xanthus.

How might structural studies of nuoK contribute to understanding bacterial respiratory complex assembly?

Advanced structural analysis of nuoK can provide insights into fundamental questions about respiratory complex biogenesis:

• Membrane protein integration mechanisms:

  • NuoK, as a small membrane subunit, serves as an excellent model for studying membrane protein assembly

  • Structural determination in different lipid environments could reveal lipid-protein interactions critical for complex formation

  • Analysis of assembly intermediates would illuminate the sequential construction of large respiratory complexes

• Technical approaches for structural studies:

  • Cryo-electron microscopy of intact respiratory complexes at various assembly stages

  • Cross-linking mass spectrometry to identify contact points between nuoK and other subunits

  • Hydrogen-deuterium exchange mass spectrometry to identify protected interfaces during assembly

  • Site-directed spin labeling coupled with electron paramagnetic resonance to monitor conformational changes

• Comparative structural biology:

  • Analysis of nuoK structure across diverse bacterial species could reveal evolutionary constraints on respiratory complex architecture

  • Identification of conserved interaction motifs versus variable regions might explain species-specific assembly patterns

  • Correlation of structural features with ecological niches (predatory versus non-predatory bacteria)

• Applied research potential:

  • Insights from nuoK assembly could inform the design of antimicrobials targeting respiratory complex formation

  • Understanding of membrane protein integration mechanisms has broader implications for membrane protein engineering

  • Principles derived from bacterial systems may inform research on mitochondrial complex I assembly disorders

These structural studies would contribute not only to understanding M. xanthus biology but also to broader knowledge of energy-generating complexes across all domains of life.