Recombinant Myxococcus xanthus UPF0060 membrane protein MXAN_4406 (MXAN_4406)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Myxococcus xanthus UPF0060 Membrane Protein MXAN_4406

Myxococcus xanthus is a Gram-negative bacterium known for its unique social behaviors, including cooperative predation and fruiting body formation . MXAN_4406 is a membrane protein from M. xanthus that belongs to the UPF0060 family . Proteins of this family have unknown function.

Role of Myxococcus xanthus

M. xanthus displays a predatory behavior, hunting other microbes in groups reminiscent of wolf packs . This bacterium produces outer membrane vesicles (OMVs) in large quantities, which are organized in the extracellular environment and can link neighboring cells within a biofilm . These OMVs act as vehicles, delivering hydrolytic enzymes and antibiotics to kill prey microbes, thus mediating the "wolf pack" predation strategy .

Outer Membrane Vesicles (OMVs) and Their Cargo

The OMVs of M. xanthus contain a diverse cargo of proteins and small molecules . Proteomic analysis of OMVs has identified proteins with hydrolytic functions, such as peptidases, proteases, chitinases, phosphoesterases, hydratases, and nucleases . Several proteins predicted to be involved in extracellular functions, such as pilus proteins and adhesins, have also been found in OMVs .

Importance of Membrane Proteins in Myxococcus xanthus

Membrane proteins are critical for various cellular processes in bacteria, including nutrient transport, cell-cell interactions, and maintaining cell structure . In M. xanthus, a 115-kDa membrane protein, Oar, is essential for cellular adhesiveness during development . The precise role of MXAN_4406, a UPF0060 family membrane protein, remains unknown, but its presence suggests a potential role in cell-cell interactions, biofilm formation, or other functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MXAN_4406; UPF0060 membrane protein MXAN_4406
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Myxococcus xanthus (strain DK 1622)
Target Names
MXAN_4406
Target Protein Sequence
MNLLYAFGLFVLTAVAEVVGCYLPYLWLRQGKSPLLLVPAAGSLAVFAWLLTLHPTGAAR TYAAYGGVYIAVALVWLWLVEGERPTTWDLVGALVAILGMAIIVLGPRR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What methodologies are used for recombinant expression of MXAN_4406?

Recombinant expression of MXAN_4406 is typically achieved through heterologous expression in E. coli systems. The methodological approach involves:

  • Gene synthesis or PCR amplification of the MXAN_4406 coding sequence

  • Cloning into an expression vector with an N-terminal His-tag

  • Transformation into E. coli expression strains

  • Induction of protein expression under optimized conditions

  • Cell harvesting and lysis

  • Purification via immobilized metal affinity chromatography (IMAC)

  • Secondary purification steps (e.g., size exclusion chromatography)

  • Final preparation as a lyophilized powder

For optimal expression, researchers should consider:

  • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Employing low-temperature induction (16-18°C) to reduce inclusion body formation

  • Including glycerol (5-10%) in purification buffers to enhance stability

  • Reconstituting the purified protein in suitable detergent micelles or lipid environments

How is MXAN_4406 related to the Ω4406 regulatory region?

The Ω4406 regulatory region is a developmentally regulated promoter in M. xanthus that controls the expression of genes including MXAN_4406. Research has established that:

  • The Ω4406 region is a C-signal-dependent promoter, meaning its activity increases in response to C-signaling during M. xanthus development

  • The promoter is located approximately 1.3 kb upstream of the Ω4406 transposon insertion site

  • A 1.0-kb DNA segment (from 0.8 to 1.8 kb upstream of the insertion) contains the core promoter activity

  • Expression controlled by this promoter is abolished in csgA mutants (which cannot produce C-signal)

  • Expression can be restored when csgA mutants are co-developed with wild-type cells that supply the C-signal

The developmentally regulated nature of this region suggests MXAN_4406 may play a role in the complex developmental processes of M. xanthus, potentially in fruiting body formation or sporulation.

What are the optimal methods for maintaining structural integrity of MXAN_4406 during purification?

Maintaining the structural integrity of membrane proteins like MXAN_4406 during purification represents a significant challenge. The following methodological approaches are recommended based on current research:

Table 1: Comparison of Purification Methods for MXAN_4406

MethodAdvantagesDisadvantagesRecommended Protocol
Detergent-basedWell-established protocolsRisk of over-delipidationUse mild detergents (DDM, LMNG); include lipids during purification
SMA-basedPreserves native lipid environmentLimited buffer compatibilityExtract directly from membranes with 2:1 or 3:1 SMA polymers
DIBMA-basedBetter buffer compatibilityLess efficient extractionOptimize polymer-to-lipid ratios for MXAN_4406
CyclAPol-basedEnables high-resolution structural studiesLess established protocolsConsider for projects requiring structural determination

For detergent-free approaches, recent advances in membrane protein structural biology suggest:

  • Styrene-maleic acid lipid particles (SMALP) directly extract membrane proteins with surrounding lipids, preserving the native environment

  • DIBMA (diisobutylene maleic acid) offers advantages for spectroscopic studies

  • Novel polymers like CyclAPol show promise for high-resolution structural studies

Storage recommendations for purified MXAN_4406 include:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Consider addition of 6% trehalose for stability

  • For reconstitution, use deionized water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol for long-term storage

How should experimental design be approached when studying MXAN_4406 expression during Myxococcus xanthus development?

Investigating MXAN_4406 expression during M. xanthus development requires careful experimental design to account for the complex developmental processes. A methodological framework should include:

Baseline Establishment

  • Quantify MXAN_4406 expression in vegetative cells using qRT-PCR

  • Create transcriptional reporter fusions with lacZ to monitor expression patterns

  • Establish growth curves in standard conditions

Developmental Time Course Analysis

  • Induce development by starvation on appropriate media

  • Collect samples at defined time points (0, 6, 12, 24, 48 hours)

  • Measure expression using qRT-PCR or reporter assays

  • Document morphological changes using microscopy

C-Signal Dependency Testing

  • Compare expression in wild-type and csgA mutant strains

  • Perform mixing experiments with varying ratios of csgA mutants and wild-type cells

  • Quantify MXAN_4406 expression levels relative to C-signal availability

4. Chromosomal Context Evaluation
A critical methodological consideration identified in previous research is that expression of reporter constructs can be significantly affected by chromosomal position:

  • Test expression when the reporter is at the native MXAN_4406 locus

  • Compare with expression when integrated at the Mx8 phage attachment site (attB)

  • Identify potential inhibitory DNA segments that affect expression in different contexts

Statistical Analysis

  • Perform at least three biological replicates

  • Use appropriate statistical tests (e.g., ANOVA with post-hoc analysis)

  • Consider non-parametric methods for developmental time course data

This comprehensive approach enables robust characterization of MXAN_4406 expression patterns during development while accounting for the complex regulatory mechanisms involved in M. xanthus differentiation.

What approaches can be used to determine the membrane topology of MXAN_4406?

Determining the membrane topology of MXAN_4406 requires integrating computational and experimental approaches. The following methodology is recommended:

Computational Approaches:

  • Use multiple topology prediction algorithms (TMHMM, Phobius, TOPCONS)

  • Perform comparative analysis with other UPF0060 family proteins

  • Apply molecular dynamics simulations in a lipid bilayer environment

  • Generate a consensus model from diverse prediction methods

Experimental Validation:

  • Substituted Cysteine Accessibility Method (SCAM)

    • Introduce single cysteines at predicted loops/termini

    • Test accessibility using membrane-impermeable sulfhydryl reagents

    • Map accessible vs. protected regions to define topology

  • Reporter Fusion Approach

    • Create sequential truncations fused to dual reporters:

      • PhoA (active in periplasm)

      • GFP (active in cytoplasm)

    • Analyze activity patterns to determine orientation

  • Protease Protection Assays

    • Express MXAN_4406 in membrane vesicles

    • Treat with proteases under various conditions

    • Identify protected fragments using mass spectrometry

  • Cross-Linking Analysis

    • Use membrane-impermeable cross-linkers

    • Identify interaction partners in different compartments

    • Map crosslinked residues to refine topological model

The integration of these approaches provides the most robust topology determination, with discrepancies between methods serving as opportunities to identify dynamic or context-dependent structural features of MXAN_4406.

How can single-case experimental designs be applied to study MXAN_4406 function in myxobacterial social behavior?

Single-case experimental designs (SCEDs) offer rigorous approaches for establishing causal relationships between MXAN_4406 and M. xanthus social behaviors. The following methodological framework adapts SCED principles to bacterial systems:

Reversal Design (A-B-A-B)
This design establishes causality through systematic introduction and withdrawal of interventions:

  • Baseline Phase (A1): Document social behaviors in wild-type M. xanthus strains

  • Intervention Phase (B1): Induce MXAN_4406 overexpression or deletion

  • Return to Baseline (A2): Suppress overexpression or complement deletion

  • Reintroduction of Intervention (B2): Re-induce original manipulation

This approach requires inducible genetic systems that allow precise temporal control of MXAN_4406 expression.

Multiple Baseline Design
This design staggers interventions across different behaviors or conditions:

  • Select multiple social behaviors potentially influenced by MXAN_4406:

    • Fruiting body formation

    • Predatory swarming

    • Outer membrane exchange dynamics

  • Introduce MXAN_4406 manipulation at different time points for each behavior

  • Observe whether changes coincide specifically with the manipulation

Methodological Considerations:

  • Each phase should continue until stability is evident, with at least 5 data points

  • Absence of trends in the expected direction should be established before phase transitions

  • At least three replications are needed for confidence in causal relationships

  • Random assignment of intervention timing strengthens internal validity

Data Analysis Framework:

  • Visual analysis of trend, level, and variability across phases

  • Calculation of effect sizes (percentage of non-overlapping data)

  • Statistical analysis using appropriate time-series methods

This methodology enables researchers to establish whether MXAN_4406 has direct causal effects on social behaviors while controlling for confounding variables that might influence M. xanthus development .

What are the optimal detergent-free systems for structural studies of MXAN_4406?

For structural studies of membrane proteins like MXAN_4406, detergent-free systems offer significant advantages by preserving the native lipid environment. The following methodological analysis outlines optimal approaches:

Table 2: Comparison of Detergent-Free Systems for MXAN_4406 Structural Studies

SystemExtraction MethodStructural TechniquesResolution PotentialNative Lipid Retention
SMALPDirect extraction with SMA copolymersCryo-EM, SAXS, NMRHigh (3-4Å)High
DIBMALPDirect extraction with DIBMACryo-EM, spectroscopic methodsModerate-highHigh
CyclAPolExtraction with C8-C0-50Cryo-EM (≤3.2Å reported)Very highModerate-high
NCMNSpecialized membrane extractionCryo-EM, AFMHighVery high

Methodological Considerations for SMALP:

  • The most established detergent-free system with proven success for various membrane proteins

  • Use styrene-maleic acid copolymers to extract MXAN_4406 directly from membranes

  • Optimize polymer-to-lipid ratios for effective extraction

  • Note limitations: incompatible with divalent cations and low pH conditions

  • Successfully used for high-resolution cryo-EM structures of several membrane proteins

DIBMA Advantages:

  • Less interference with spectroscopic techniques

  • Compatible with a wider range of buffer conditions

  • Better suited for functional studies requiring divalent cations

  • Demonstrated success with mechanosensitive channel YnaI from E. coli

CyclAPol Considerations:

  • Novel polymers designed to overcome limitations of SMA

  • Enables very high-resolution structural studies

  • Has been used successfully for structure determination at 3.2Å resolution

  • Optimization required for specific membrane proteins like MXAN_4406

NCMN System Benefits:

  • Preserves more native membrane environment

  • Particularly valuable for proteins that function within membrane complexes

  • Successful with connexin 26 structure determination

The choice between these systems should be guided by the specific research questions about MXAN_4406, with SMALP offering the most established protocols for initial characterization, while newer approaches like CyclAPol may be advantageous for high-resolution structural studies.

How might MXAN_4406 function interact with outer membrane exchange (OME) in Myxococcus xanthus?

The potential relationship between MXAN_4406 and outer membrane exchange (OME) represents an intriguing research question, given that both involve membrane processes. A systematic experimental approach to investigate this relationship would include:

Theoretical Framework:
MXAN_4406 is a membrane protein with unknown function, while OME is a process unique to myxobacteria whereby cells exchange outer membrane materials through direct contact, facilitated by TraA and TraB proteins. Potential relationships include:

  • MXAN_4406 could be transferred during OME events

  • MXAN_4406 might regulate OME efficiency

  • MXAN_4406 could influence membrane architecture relevant to OME

  • OME might affect MXAN_4406 distribution or function

Experimental Approach 1: MXAN_4406 Transfer During OME

  • Create donor strain with fluorescently tagged MXAN_4406

  • Mix with recipient strain lacking the tagged protein

  • Monitor potential transfer using fluorescence microscopy

  • Compare transfer efficiency with established OME cargo proteins

  • Use Western blotting to quantify transfer rates

Experimental Approach 2: Effect of MXAN_4406 on OME Efficiency

  • Generate MXAN_4406 deletion and overexpression strains

  • Assess OME efficiency using established transfer assays:

    • Fluorescent lipid dye transfer measurements

    • Tagged protein transfer quantification

    • Motility complementation assays

  • Compare with controls (wild-type and traA/traB mutants)

Experimental Approach 3: MXAN_4406 Localization During OME

  • Create fluorescent protein fusions that maintain MXAN_4406 function

  • Monitor localization before, during, and after OME events

  • Determine if MXAN_4406 concentrates at sites of cell-cell contact

  • Assess co-localization with TraA and TraB proteins

Table 3: Predicted Outcomes Based on Hypothetical MXAN_4406 Functions

Hypothetical FunctionOME Transfer PredictionEffect on OME When DeletedTraA/TraB Interaction
OME cargo proteinEfficient transferMinimal effectPotential TraA recognition
OME regulatorNo transferAltered OME efficiencyDirect or indirect interaction
Membrane structure proteinNo transferSecondary effects on OMENo direct interaction
Unrelated functionNo transferNo effectNo interaction

The social nature of M. xanthus, including its complex cell-cell interactions during predation and development, suggests potential involvement of membrane proteins like MXAN_4406 in these processes. The OME mechanism represents a unique form of bacterial communication that might intersect with MXAN_4406 function, particularly given that both are subject to developmental regulation .

What methodological approaches can resolve contradictory data regarding MXAN_4406 function?

When investigating a protein of unknown function like MXAN_4406, researchers often encounter seemingly contradictory results across different experimental systems. The following methodological framework provides a systematic approach to resolve such contradictions:

Step 1: Data Validation and Quality Assessment

  • Re-examine raw data for technical issues

  • Verify reagent quality and specificity

  • Assess statistical power and reproducibility

  • Identify potential artifacts from protein tags or expression systems

Step 2: Cross-Validation Using Orthogonal Techniques
For each contradictory finding, apply multiple independent methods:

  • If localization data conflicts between systems, use multiple tagging strategies and visualization techniques

  • If functional assays give contradictory results, apply complementary methodologies

  • If structural predictions conflict with experimental data, use site-directed mutagenesis to test specific hypotheses

Step 3: Context-Dependent Analysis

  • Map each finding to specific experimental conditions

  • Test boundary conditions systematically to identify transition points

  • Determine if contradictions represent different functional states rather than experimental artifacts

Table 4: Decision Matrix for Resolving Contradictory MXAN_4406 Data

Contradiction TypeVerification ApproachResolution StrategySuccess Indicator
Localization discrepancyMultiple tagging methodsTest condition-dependent localizationConsistent pattern across methods
Functional differenceRemove tags; vary expressionIdentify threshold effectsUnified model explaining differences
Interaction conflictsIn vivo crosslinking; competition assaysMap interaction conditionsStructural model accommodating all data
Phenotypic varianceControl genetic backgroundDetermine epistatic relationshipsNetwork model explaining differences

Step 4: Integrate Position-Dependent Effects
Research on the Ω4406 region revealed that chromosomal position significantly affects gene expression, with a 0.8-kb DNA segment inhibiting expression when at the phage attachment site but not at the native location . This observation suggests:

  • Test MXAN_4406 function in its native chromosomal context

  • Compare with function when expressed from other locations

  • Consider position effects in interpreting seemingly contradictory data

Step 5: Consider Developmental Context
Given that MXAN_4406 is regulated by a developmentally controlled promoter, apparent contradictions might reflect different developmental states:

  • Test function across the developmental cycle

  • Compare vegetative versus developmental expression and function

  • Examine function in the context of multicellular behaviors

This systematic approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding of MXAN_4406 function in the complex social behaviors of M. xanthus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.