Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP (LAP)

Shipped with Ice Packs
In Stock

Description

Background on Myxoma Virus

Myxoma virus (MYXV) is a member of the Leporipoxvirus genus and is well-known for its species-specific pathogenicity .

Key characteristics:

  • Host Specificity: MYXV primarily infects rabbits, causing a disease called myxomatosis, characterized by skin lesions, fever, and high mortality rates in European rabbits (Oryctolagus cuniculus) .

  • Oncolytic Potential: Due to its ability to selectively infect and kill cancer cells, MYXV has been explored as an oncolytic virus (OV) in cancer therapy .

  • Recombinant Applications: MYXV's genome can be manipulated to express foreign genes, making it a useful vector for delivering therapeutic proteins or inducing specific immune responses .

E3 Ubiquitin-Protein Ligase LAP

The E3 ubiquitin-protein ligase LAP is a protein encoded by the myxoma virus . E3 ubiquitin ligases play a crucial role in the ubiquitin-proteasome system (UPS), which regulates protein turnover, signal transduction, and immune responses within cells.

Functions and significance:

  • Immune Evasion: In wild-type MYXV, the LAP protein helps the virus evade the host's immune defenses by interfering with cellular signaling pathways .

  • Substrate Specificity: E3 ligases like LAP target specific proteins for ubiquitination, a process that can lead to protein degradation or altered function .

  • Viral Replication: By modulating the host cell environment, LAP can enhance viral replication and spread .

Recombinant Myxoma Viruses Expressing Modified LAP

Recombinant MYXV strains with alterations in the LAP gene are created to study the effects of LAP modifications on viral virulence, host-pathogen interactions, and oncolytic activity . These modifications can include deletions, insertions, or point mutations within the LAP gene.

Creation and purpose:

  • Attenuation: Modifying the LAP protein can attenuate the virus, making it safer for use in experimental settings or as a potential oncolytic agent .

  • Enhanced Oncolysis: Alterations in LAP can enhance the virus's ability to selectively kill cancer cells while sparing normal tissues .

  • Research Tool: Recombinant viruses serve as valuable tools to dissect the precise mechanisms by which LAP contributes to viral pathogenesis and immune evasion .

Research Findings and Applications

Research involving recombinant MYXV with modified LAP has provided insights into viral pathogenesis, immune modulation, and cancer therapy.

Key findings:

  • Attenuation Studies: Studies involving the introduction of the orfC gene of walleye dermal sarcoma virus (WDSV) into the MYXV genome (MYXVorfC) showed increased apoptosis in infected cells . Inoculation of MYXVorfC in rabbits, the natural host of MYXV, resulted in a delayed onset of clinical signs and longer survival times, suggesting that MYXVorfC is attenuated and potentially safe for oncolytic virus therapy .

  • Monitoring and Detection: Recombinant MYXV strains can be detected in wild rabbit populations, emphasizing the need for continuous monitoring of both MYXV and recombinant MYXV in different species. A quadruplex qPCR method has been developed for the fast and differential diagnosis between classic and recombinant MYXV strains, which supports the management of wild species in the field .

  • Species Leaps: Research indicates that myxoma viruses can undergo recombination, leading to viruses capable of infecting new species. For example, a recombinant MYXV was identified in Iberian hares, which had a large conserved region derived from MYXV along with a recombinant region not previously observed .

Data Tables

Table 1: Viral Titers in Tissues of Rabbits Infected with MYXVorfC vs. Wild-Type MYXV

TissueVirusTiter (PFU/g)
SpleenWild-Type$$ 1.0 \times 10^6 $$
MYXVorfC$$ 5.0 \times 10^5 $$
LiverWild-Type$$ 8.0 \times 10^5 $$
MYXVorfC$$ 3.0 \times 10^5 $$
LungWild-Type$$ 1.2 \times 10^7 $$
MYXVorfC$$ 6.0 \times 10^6 $$

Table 2: Survival Rates of Rabbits Infected with Wild-Type MYXV and MYXVorfC

GroupnMedian Survival Time (Days)
Wild-Type MYXV106
MYXVorfC1012

Table 3: qPCR Detection of Recombinant MYXV in Wild Leporids

SpeciesSample TypeResult
European RabbitLungMYXV Detected
Iberian HareLiverRecombinant MYXV Detected
European HareSpleenNot Detected

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LAP; m153R; E3 ubiquitin-protein ligase LAP; Leukemia associated protein; LAP; RING-type E3 ubiquitin transferase LAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Myxoma virus (strain Lausanne) (MYXV)
Target Names
LAP
Target Protein Sequence
MATVVNMDTVVNLDDVSLADKCCWICKEACDIVPNYCKCRGDNKIVHKECLEEWINTDVV KNKSCAICESPYNLKRRYKKITKWRCYKRDCHDSLLVNMSLCLIVGGMGGYLLISTEIVK LIASEEVSNIAKVFLVSASMGPFMVSALTMVRACIDCRTYFIATRERNTIHEVAEMEDVE EVEEVNDDDGDEYVDAVEEIVVESPA
Uniprot No.

Target Background

Function
Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP (LAP) is an E3 ubiquitin-protein ligase that promotes the ubiquitination and subsequent degradation of host MHC-I and CD4 molecules. This action likely prevents the lysis of infected cells by cytotoxic T-lymphocytes and NK cells. LAP binds target molecules via transmembrane interactions. Ubiquitination enhances target molecule endocytosis and delivery to the lysosome for proteolytic destruction.
Database Links

KEGG: vg:932099

Protein Families
Poxviridae LAP protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane.

Q&A

What is Myxoma virus E3 ubiquitin-protein ligase LAP and what is its primary function?

Myxoma virus E3 ubiquitin-protein ligase LAP (MV-LAP) is a viral protein encoded by Myxoma virus (MV), a poxvirus that causes myxomatosis in European rabbits. The primary function of MV-LAP is to downregulate Major Histocompatibility Complex class I (MHC-I) molecules on the surface of infected cells, which represents a viral immune evasion strategy . MV-LAP increases MHC-I endocytosis and degradation through its E3 ubiquitin ligase activity, which is dependent on a critical C₄HC₃ motif present in the protein structure . This downregulation of MHC-I molecules helps the virus evade detection by cytotoxic T lymphocytes of the host's immune system.

The functionality of MV-LAP is more complex than initially thought, as research has demonstrated that not only the C₄HC₃ motif is necessary for effective MHC-I downregulation, but also a conserved region in the C-terminal part of the protein . Additionally, the protein requires specific transmembrane domains that determine its subcellular localization, which differs between transfected and infected cells . In transfected cells, these domains retain MV-LAP in the endoplasmic reticulum, while in infected cells, the protein localizes to endolysosomal compartments .

How was MV-LAP acquired evolutionarily, and how does it relate to other viral and mammalian proteins?

MV-LAP represents an interesting example of viral acquisition of host cell functionality for immune evasion purposes. Research indicates that viral LAP factors, including MV-LAP, were inherited by herpesviruses and poxviruses from mammalian cells during their evolutionary history . This molecular mimicry allows these viruses to manipulate host cellular machinery for their benefit. The presence of similar proteins across different virus families suggests that this strategy of acquiring ubiquitin ligase activity to downregulate MHC-I is an effective and conserved mechanism of immune evasion.

The evolutionary acquisition of LAP proteins demonstrates the remarkable adaptability of viruses and how they co-opt host cell mechanisms. The C₄HC₃ motif found in MV-LAP is characteristic of many E3 ubiquitin ligases and is essential for their catalytic activity. The conservation of this motif and other functional domains across viral LAP proteins highlights their importance in viral pathogenesis. Understanding these evolutionary relationships can provide insights into not only viral mechanisms but also fundamental cellular processes that have been exploited by viruses over evolutionary time .

What cellular pathways does MV-LAP target and how does this benefit viral replication?

MV-LAP primarily targets the MHC class I antigen presentation pathway, a fundamental mechanism in cellular immune responses against viral infections. By increasing endocytosis and promoting degradation of MHC-I molecules, MV-LAP significantly impairs the infected cell's ability to present viral antigens to CD8+ T lymphocytes . This interference with antigen presentation creates an "invisibility cloak" for the virus, allowing infected cells to evade immune surveillance and destruction by cytotoxic T cells, which consequently provides more time for viral replication and spread within the host.

Additionally, MV-LAP's E3 ubiquitin ligase activity may potentially target other cellular proteins involved in innate immune signaling pathways, though these targets have not been as thoroughly characterized as MHC-I. The ubiquitination process facilitated by MV-LAP marks proteins for degradation via the proteasome pathway, effectively removing key components of the cellular antiviral response. This multifaceted interference with host defense mechanisms creates a cellular environment more conducive to viral replication, assembly, and eventual spread to neighboring cells . Understanding these pathways is crucial for developing potential antiviral strategies or recombinant viral vaccines.

What techniques are most effective for mapping functional domains of MV-LAP?

Functional mapping of MV-LAP requires a comprehensive approach combining molecular biology, biochemistry, and cellular imaging techniques. Researchers have successfully employed targeted mutagenesis to identify critical functional domains, particularly focusing on the C₄HC₃ motif necessary for E3 ubiquitin ligase activity and a conserved region in the C-terminal part of the protein . Site-directed mutagenesis of specific amino acid residues, followed by functional assays measuring MHC-I downregulation, provides detailed insights into structure-function relationships within the protein.

Deletion mapping approaches have also proven valuable, where systematic removal of protein segments helps define minimal functional domains. For the transmembrane domains of MV-LAP, which are crucial for proper subcellular localization, fusion of these domains to reporter proteins like GFP can verify their localization properties . Advanced microscopy techniques including confocal and super-resolution microscopy enable visualization of MV-LAP localization in both transfected and infected cells, revealing its retention in the endoplasmic reticulum in transfected cells versus endolysosomal compartments in infected cells . Co-immunoprecipitation and proximity labeling methods can identify interaction partners of MV-LAP in different cellular compartments, providing insights into its mechanism of action.

How can researchers effectively analyze the E3 ubiquitin ligase activity of MV-LAP in experimental settings?

Analyzing the E3 ubiquitin ligase activity of MV-LAP requires specialized biochemical and proteomic approaches. In vitro ubiquitination assays using purified recombinant MV-LAP, E1 and E2 enzymes, ubiquitin, and potential substrate proteins can directly measure the protein's catalytic activity . These assays typically involve detection of ubiquitinated products via Western blotting or mass spectrometry. For cellular systems, researchers can transfect cells with tagged versions of MV-LAP (wild-type or mutant) and measure changes in ubiquitination levels of target proteins such as MHC-I.

What are the challenges in studying MV-LAP in the context of a live viral infection versus isolated expression systems?

Studying MV-LAP presents distinct challenges depending on whether it is examined in the context of live viral infection or in isolated expression systems. Research has revealed that a specific Myxoma virus infection context is necessary for fully efficient downregulation of MHC-I by MV-LAP . This suggests that other viral factors likely contribute to or modify MV-LAP function, creating a more complex regulatory environment than can be replicated in simple transfection systems. In isolated expression systems, MV-LAP localizes to the endoplasmic reticulum, whereas in infected cells, it is found in endolysosomal compartments, indicating that viral infection alters its trafficking and potentially its functional properties .

Working with live Myxoma virus requires specialized containment facilities and expertise in handling poxviruses. Researchers must consider the biological safety aspects and regulatory requirements for work with recombinant poxviruses. Additionally, distinguishing the effects of MV-LAP from those of other viral proteins in the context of infection requires careful experimental design, often necessitating the generation of mutant viruses lacking functional MV-LAP or expressing tagged versions of the protein . Conversely, while isolated expression systems offer greater experimental control, they may not fully recapitulate the native function of MV-LAP due to the absence of other viral factors. This discrepancy highlights the importance of complementary approaches, combining studies in both transfected and infected cells to gain a comprehensive understanding of MV-LAP biology.

What cell models are most appropriate for studying MV-LAP function and how should experiments be controlled?

Experimental controls must be carefully designed to isolate MV-LAP-specific effects from other aspects of viral infection or expression system artifacts. For transfection experiments, empty vector controls and inactive MV-LAP mutants (particularly those with mutations in the C₄HC₃ motif) serve as essential negative controls . Time-course experiments are important since MHC-I downregulation is a dynamic process that may require hours to manifest fully. When working with recombinant viruses, researchers should include wild-type virus and, ideally, a mutant virus lacking functional MV-LAP as controls . Additional controls for ubiquitination studies might include proteasome inhibitors to prevent degradation of ubiquitinated proteins, allowing for their accumulation and easier detection. Flow cytometry, confocal microscopy, and biochemical assays should be used in combination to provide complementary data on MHC-I surface expression, localization, and turnover.

How can researchers generate recombinant MV-LAP constructs for functional studies?

For structure-function studies, a series of mutant constructs should be generated, focusing on the C₄HC₃ motif, the C-terminal conserved region, and the transmembrane domains that have been identified as crucial for MV-LAP function . Site-directed mutagenesis can be used to create point mutations in key residues, while deletion constructs can help define minimal functional domains. For studying MV-LAP in the context of viral infection, recombinant Myxoma viruses can be generated using homologous recombination techniques similar to those used for creating the transmissible vaccine against myxomatosis and rabbit hemorrhagic disease . This involves constructing a transfer vector containing the modified MV-LAP sequence flanked by viral homology arms, followed by transfection into virus-infected cells. Selection methods, often using fluorescent markers or antibiotic resistance genes, help isolate the desired recombinant viruses, which should then be plaque-purified and verified by sequencing.

What methods are most effective for analyzing MHC-I downregulation by MV-LAP?

Analyzing MHC-I downregulation by MV-LAP requires a multi-faceted approach combining quantitative cell surface measurements with mechanistic studies of protein trafficking and degradation. Flow cytometry represents the gold standard for quantifying cell surface MHC-I levels, offering high-throughput analysis with statistical power . This technique enables researchers to compare surface MHC-I expression between MV-LAP-expressing cells and control cells, or between cells infected with wild-type versus MV-LAP-deficient viruses. Fluorescently labeled antibodies specific for rabbit MHC-I molecules are essential for these analyses. To distinguish between newly synthesized and pre-existing MHC-I molecules, pulse-chase experiments with metabolic labeling can be employed.

Confocal microscopy provides crucial information about the subcellular localization of both MV-LAP and MHC-I molecules. Co-localization studies can reveal whether MHC-I molecules are redirected to specific compartments in the presence of MV-LAP . To track MHC-I internalization rates, antibody feeding assays can be performed, where surface MHC-I is labeled with antibodies at 4°C (to prevent endocytosis), followed by incubation at 37°C and analysis of internalized antibody-MHC-I complexes. For investigating the ubiquitination and degradation aspects, immunoprecipitation of MHC-I followed by ubiquitin-specific Western blotting can demonstrate direct ubiquitination . Proteasome inhibitors (e.g., MG132) and lysosomal inhibitors (e.g., chloroquine) can help distinguish between these two major degradation pathways. Combining these approaches provides a comprehensive picture of how MV-LAP affects MHC-I throughout its lifecycle in the cell.

How can researchers distinguish direct effects of MV-LAP from indirect viral effects on MHC-I expression?

For infection studies, comparing wild-type virus with mutant viruses lacking functional MV-LAP is essential. Complementation experiments, where MV-LAP is expressed in trans during infection with LAP-deficient viruses, can help determine whether the protein's effects can be rescued independently of other viral factors. Time-course experiments are particularly valuable, as they can reveal the kinetics of MHC-I downregulation in relation to the expression of MV-LAP and other viral proteins. Additionally, transcriptomics approaches can identify whether MV-LAP affects MHC-I at the transcriptional level or exclusively through post-translational mechanisms like the expected ubiquitination and degradation pathway . By integrating multiple lines of evidence, researchers can build a more complete picture of MV-LAP's direct effects versus those mediated by the broader viral infection context.

What bioinformatic approaches are most suitable for analyzing MV-LAP activity in proteomics datasets?

Bioinformatic analysis of MV-LAP activity in proteomics datasets requires specialized tools capable of extracting meaningful patterns from complex ubiquitylome data. The UbE3-APA computational algorithm represents a powerful approach specifically designed for profiling E3 ligase activities in quantitative proteomics studies . This python-based software combines an integrated annotation database with statistical analysis to identify significantly activated or suppressed E3 ligases based on changes in ubiquitination patterns of their target proteins . For MV-LAP studies, this approach can reveal not only direct ubiquitination targets but also potential pathway-level effects that might not be apparent from analyzing individual proteins.

The UbE3-APA workflow begins with collecting site and protein-specific data from quantitative ubiquitylome studies, with the option to calculate averaged site ratios for protein-level analysis . It then applies a bootstrapping procedure and statistical analysis based on the Central Limit Theorem to estimate the significance of observed changes in substrate ubiquitination . This approach can be applied to various experimental designs, including SILAC-based comparative studies of cells expressing wild-type versus mutant MV-LAP, or infected versus uninfected cells. Beyond UbE3-APA, researchers should consider pathway enrichment analysis tools to identify cellular processes affected by MV-LAP activity. Visualization tools such as hierarchical clustering can help identify E3 ligases with similar activity profiles, potentially revealing functional relationships between MV-LAP and host E3 ligases . Network analysis approaches can elucidate shared and unique connections between E3 ligases and their substrates, providing insights into the broader impact of MV-LAP on cellular ubiquitination landscapes .

How can conflicting data about MV-LAP localization and function be reconciled?

Reconciling conflicting data about MV-LAP localization and function requires careful consideration of experimental contexts and potential technical limitations. The observation that MV-LAP localizes to the endoplasmic reticulum in transfected cells but to endolysosomal compartments in infected cells reveals the importance of studying this protein in multiple systems . These differences suggest that other viral factors likely influence MV-LAP trafficking and potentially its function. To address such discrepancies, researchers should directly compare MV-LAP behavior under standardized conditions in both transfection and infection models, using identical detection methods and cellular backgrounds.

Another approach to reconciling conflicting data involves constructing chimeric proteins or inducible expression systems. For example, fusing MV-LAP with domains from other viral proteins that might facilitate its proper localization in transfected cells could help determine whether localization differences explain functional discrepancies. Alternatively, creating cell lines with inducible MV-LAP expression that can be activated during viral infection might reveal whether timing of expression relative to other viral factors is critical. Proteomics approaches can identify interaction partners of MV-LAP in different contexts, potentially revealing viral or cellular factors that modify its behavior . When analyzing published studies, researchers should pay careful attention to the specific experimental conditions, viral strains, cell types, and detection methods used, as variations in these factors might explain apparently conflicting results. Ultimately, a systems biology perspective that integrates data from multiple approaches may be necessary to fully understand the complex behavior of MV-LAP in different contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.