Recombinant Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrC; nqr3; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-256
Protein Length
Full Length of Mature Protein
Species
Vibrio alginolyticus
Target Names
nqrC
Target Protein Sequence
ASNNDSIKKTLGVVIGLSLVCSIIVSTAAVGLRDKQKANAVLDKQSKIVEVAGIDANGKK VPELFAEYIEPRLVDLETGNFTEGNASTYDQREASKDAERSIALTPEEDVADIRRRANTA VVYLVKDQDEVQKVILPMHGKGLWSMMYAFVAVETDGNTVSAITYYEQGETPGLGGEVEN PSWRDQFIGKKLYNEDHQPAIKVVKGGAPQGSEHGVDGLSGATLTSNGVQHTFDFWLGDK GFGPFLAKVRDGELN
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA through NqrE proteins are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Na+-translocating NADH:quinone oxidoreductase (NQR) and its subunit C (nqrC)?

Na+-translocating NADH:quinone oxidoreductase (NQR) is a redox-driven sodium pump operating in the respiratory chain of various bacteria, including pathogenic species. It functions as a key enzyme complex in bacterial energy metabolism, coupling the oxidation of NADH to quinone with the translocation of sodium ions across the membrane to generate an electrochemical gradient used for energy conservation . The complete enzyme contains a unique set of redox-active prosthetic groups essential for its electron transfer function.

NqrC is one of the key subunits of this enzyme complex, characterized by its covalently bound flavin mononucleotide (FMN) attached to a threonine residue . This covalent attachment represents a distinctive structural feature that significantly impacts the subunit's function within the larger NQR complex. As part of the respiratory chain, nqrC plays a crucial role in the sequential transfer of electrons through the protein-bound prosthetic groups.

What are the structural characteristics of nqrC?

The three-dimensional structure of nqrC from Vibrio harveyi has been solved at 1.56 Å resolution, revealing several key structural features that contribute to its function . The most prominent structural characteristic is the covalently bound flavin mononucleotide (FMN) attached to a threonine residue, which serves as the primary redox-active prosthetic group in this subunit.

Detailed structural analysis shows that the isoalloxazine moiety of the FMN residue is buried within a hydrophobic cavity, with the pyrimidine ring squeezed between hydrophobic amino acid residues . Interestingly, the benzene ring of FMN extends from the protein surroundings, providing a degree of flexibility that appears crucial for its function . This structural arrangement enables the FMN residue to adopt a bent conformation that helps stabilize the one-electron reduced form of the prosthetic group.

Structural FeatureCharacteristic
Resolution1.56 Å
Prosthetic groupCovalently bound FMN
FMN attachment siteThreonine residue
Isoalloxazine locationBuried in hydrophobic cavity
Pyrimidine ring positionBetween hydrophobic amino acid residues
Benzene ring orientationExtended from protein surroundings

Why is FMN covalently bound to nqrC?

The covalent binding of FMN to nqrC serves several critical functional purposes that have been elucidated through comparative studies. Research has demonstrated very low affinity of NqrC to FMN in the absence of covalent bonding, indicating that non-covalent interactions alone are insufficient to retain this essential cofactor . This finding provides the primary explanation for the evolutionary development of covalent attachment.

Another significant factor is the periplasmic location of the FMN-binding domains in the vast majority of NqrC-like proteins . In this external-facing environment, covalent attachment prevents loss of the flavin to the periplasmic space, ensuring that this essential prosthetic group remains associated with the protein even under varying environmental conditions. The structural characteristics of the flavin-binding pocket, while providing functional benefits, also result in relatively weak non-covalent binding of the flavin .

The specific structural arrangement enabled by covalent binding also helps stabilize the one-electron reduced form of FMN, which is crucial for its function in the electron transport chain . This stabilization is facilitated by the flexibility of the benzene ring, which can adopt specific conformations that optimize electron transfer properties.

What methodologies are most effective for expressing and purifying recombinant nqrC?

Expression and purification of recombinant nqrC require specialized approaches to ensure proper folding and flavin incorporation. Based on published research protocols and structural studies that have successfully produced well-characterized nqrC:

  • Expression Systems:

    • E. coli BL21(DE3) has been successfully used for heterologous expression of nqrC

    • Codon-optimized constructs improve expression levels for bacterial proteins

    • Co-expression with molecular chaperones may enhance proper folding

  • Expression Vectors:

    • pET-based vectors with T7 promoter systems have proven effective

    • Addition of affinity tags (His6, Strep-tag II) facilitates purification

    • Inclusion of TEV protease cleavage sites enables tag removal post-purification

  • Cultivation Conditions:

    • Induction at lower temperatures (16-18°C) often improves soluble protein yield

    • Extended expression times (16-24 hours) facilitate proper folding and FMN incorporation

    • Supplementation with riboflavin in growth media can enhance flavination

  • Purification Strategy:

    • Initial capture via affinity chromatography (IMAC or Strep-Tactin)

    • Secondary purification via ion exchange chromatography

    • Final polishing via size exclusion chromatography

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • UV-visible spectroscopy to assess flavin incorporation (characteristic peaks at ~370 and ~450 nm)

    • Fluorescence spectroscopy to confirm covalent flavin attachment

When aiming to obtain holo-nqrC with covalently attached FMN, enzymatic in vitro flavination may be required if the recombinant expression system lacks the necessary flavin transferase activity. The structural studies conducted at 1.56 Å resolution demonstrate that properly folded, flavinated nqrC can be obtained through careful optimization of these methods .

How can researchers investigate the electron transfer mechanisms in nqrC?

Investigating electron transfer mechanisms in nqrC involves multiple complementary approaches that can reveal different aspects of this complex process:

  • Spectroscopic Techniques:

    • UV-visible absorption spectroscopy to monitor flavin redox state changes

    • Electron Paramagnetic Resonance (EPR) to detect and characterize radical intermediates

    • Time-resolved fluorescence to measure electron transfer kinetics

  • Electrochemical Methods:

    • Protein film voltammetry to determine redox potentials

    • Spectroelectrochemistry to correlate spectral changes with redox state

    • Potentiometric titrations to establish reduction potentials of individual redox centers

  • Structural Analysis:

    • X-ray crystallography of nqrC in different redox states, building on the established 1.56 Å resolution structure

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • Cryo-electron microscopy of the complete NQR complex to understand subunit interactions

  • Mutational Studies:

    • Site-directed mutagenesis of key residues surrounding the FMN binding site

    • Analysis of electron transfer rates in mutant variants

    • Creation of Thr→Ala mutants to prevent FMN attachment and assess effects

  • Inhibitor Studies:

    • Utilization of specific inhibitors like rotenone, piericidin A, and pyridaben

    • Photoaffinity labeling to identify binding sites of inhibitors

    • Competition assays to determine mechanisms of inhibition

These methodologies help elucidate how electrons are transferred from NADH through nqrC's FMN and ultimately to quinone, and how this process is coupled to Na+ translocation across the membrane. Research has established that the terminal electron transfer step from iron-sulfur cluster N2 to quinone represents a key area of investigation in understanding energy conservation in these systems .

What is the significance of the hydrophobic cavity surrounding the FMN in nqrC, and how can it be experimentally probed?

The hydrophobic cavity surrounding the FMN in nqrC plays a crucial role in determining the redox properties and electron transfer capabilities of this subunit. Structural studies have revealed that this cavity creates a specific microenvironment where the isoalloxazine moiety is buried and the pyrimidine ring is squeezed between hydrophobic amino acid residues . This arrangement has several significant functional implications:

  • Functional Significance:

    • Creates a specific microenvironment that tunes the redox potential of FMN

    • Enables the benzene ring flexibility that helps stabilize the one-electron reduced form of the prosthetic group

    • Provides structural constraints that position the FMN optimally for electron transfer

    • Protects the reactive flavin from undesired side reactions

  • Experimental Probes for Structural Analysis:

    • Site-directed mutagenesis of cavity-forming residues to analyze effects on FMN binding and redox properties

    • Hydrogen-deuterium exchange mass spectrometry to assess solvent accessibility

    • Molecular dynamics simulations to model cavity flexibility and solvent penetration

  • Spectroscopic Investigations:

    • Fluorescence quenching studies to assess accessibility of the FMN

    • Analysis of flavin vibrational modes using resonance Raman spectroscopy

    • Temperature-dependent spectroscopy to examine conformational flexibility

  • Functional Analysis:

    • Activity assays comparing wild-type and mutant versions of nqrC

    • pH-dependent activity profiles to assess the role of protonatable residues within the cavity

    • Temperature-dependent studies to examine the role of cavity flexibility in catalysis

The hydrophobic cavity structure appears specifically designed to provide flexibility for the benzene ring, which can help the FMN residue to take the bent conformation necessary for stabilizing the one-electron reduced form of the prosthetic group . These properties may also contribute to the relatively weak non-covalent binding of flavin observed in experimental studies .

How do researchers resolve contradictions in experimental data regarding nqrC function?

Resolving contradictions in experimental data regarding nqrC function requires systematic approaches that account for variation in experimental conditions and methodologies:

  • Methodological Standardization:

    • Standardize protein preparation protocols to ensure consistent flavination status

    • Control experimental conditions (pH, temperature, ionic strength) across studies

    • Use consistent electron donors/acceptors in functional assays

    • Develop standard reference materials for cross-laboratory validation

  • Comprehensive Analysis Techniques:

    • Employ multiple complementary methods to verify findings (e.g., spectroscopic, kinetic, and structural approaches)

    • Utilize both in vitro reconstituted systems and in vivo analyses to bridge gaps

    • Combine bulk measurements with single-molecule techniques to resolve population heterogeneity

  • Specific Contradiction Resolution Strategies:

    • For contradictory electron transfer rates: Examine differences in experimental conditions, particularly pH and salt concentration which affect Na+ coupling

    • For structural discrepancies: Compare protein preparation methods, crystallization conditions, and resolution limits

    • For functional differences: Analyze the completeness of NQR complex reconstitution across studies

Contradiction TypeResolution ApproachExpected Outcome
Structural variationsRe-solve structures under identical conditionsIdentification of conformational states or artifacts
Kinetic discrepanciesSystematic variation of reaction conditionsMapping of condition-dependent behaviors
Spectroscopic differencesCross-validation with multiple techniquesCorrelation of spectral features with functional states
Inhibitor sensitivityStandardized inhibitor purity and binding assaysEstablishment of consistent structure-activity relationships

When evaluating contradictory results, researchers should consider species-specific differences, as nqrC properties may vary between organisms like Vibrio harveyi (used in structural studies) and other bacteria containing NQR systems . Additionally, understanding the location of nqrC at the interface between hydrophilic and hydrophobic domains can help explain functional variations observed under different experimental conditions .

What are the current hypotheses regarding the coupling of electron transfer through nqrC to Na+ translocation?

Several hypotheses exist regarding how electron transfer through nqrC couples to Na+ translocation, each supported by different lines of evidence:

  • Conformational Change Model:

    • Electron transfer to/from the FMN in nqrC induces conformational changes

    • These structural rearrangements alter Na+ binding sites within the NQR complex

    • Changes in binding site affinity drive the release of Na+ on the opposite side of the membrane

    • Supporting evidence: The flexibility of the FMN benzene ring and its potential for conformational changes during redox cycling

  • Redox-coupled Binding Affinity Model:

    • The redox state of nqrC directly influences Na+ binding affinity at distant sites

    • Electron transfer alters electrostatic properties that propagate through the protein complex

    • Changes in charge distribution modify Na+ binding/release kinetics

    • Supporting evidence: The location of nqrC at the interface between hydrophilic and hydrophobic domains

  • Direct Electrostatic Interaction Model:

    • The redox centers in nqrC (including FMN) directly interact with Na+ ions

    • Electron transfer changes local charge distribution, affecting Na+ coordination

    • Sequential electron transfers drive directional Na+ movement

    • Supporting evidence: The structural arrangement of charged residues relative to the FMN binding site

  • Quinone-Mediated Coupling Model:

    • Interaction between nqrC and the quinone binding site coordinates electron and Na+ movement

    • Electron transfer from nqrC to quinone triggers conformational changes for Na+ translocation

    • The terminal electron transfer step is the key energy-conserving reaction

    • Supporting evidence: Studies showing the importance of the terminal electron transfer step from iron-sulfur cluster N2 to quinone in energy conservation

Each hypothesis remains under investigation, with researchers employing site-directed mutagenesis, spectroscopic techniques, and computational modeling to elucidate the precise coupling mechanism. The hydrophobic cavity surrounding the FMN in nqrC, with its unique structural properties enabling flexibility of the benzene ring, likely plays a key role in whatever coupling mechanism is ultimately confirmed .

What are the best approaches for studying the interface between nqrC and other NQR subunits?

Studying the interface between nqrC and other NQR subunits requires specialized techniques that can capture both structural and functional aspects of these interactions:

These approaches can help elucidate how nqrC interacts with other subunits, particularly at the interface between the hydrophilic extramembrane portion and the hydrophobic intermembrane region where nqrC is likely located based on structural and functional studies . Understanding these interfaces is critical for explaining how electron transfer through nqrC connects to both upstream electron donors and downstream acceptors in the complete NQR complex.

How can researchers effectively investigate the flavin transfer mechanism for covalent attachment to nqrC?

Investigating the flavin transfer mechanism for covalent attachment to nqrC requires strategic experimental approaches that can elucidate both the enzymatic machinery and the chemical mechanism:

  • Identification of Flavin Transferase Machinery:

    • Genetic screening for enzymes involved in FMN attachment

    • Pull-down assays using tagged nqrC to identify interacting proteins

    • Comparative genomics to identify conserved genes co-occurring with nqrC

    • Bioinformatic analysis to identify candidate flavin transferases

  • In Vitro Reconstitution:

    • Development of cell-free systems for FMN attachment

    • Purification of candidate flavin transferases

    • Time-course analysis of FMN incorporation

    • Mass spectrometric verification of covalent attachment

  • Mechanistic Studies:

    • Site-directed mutagenesis of the target threonine residue

    • Modification of surrounding residues to assess their role in recognition

    • Use of FMN analogs to probe chemical requirements

    • Kinetic isotope effect studies to examine rate-limiting steps

Experimental ApproachKey Information ObtainedTechnical Considerations
Mass spectrometryExact attachment site, reaction intermediatesRequires special sample preparation to preserve covalent bond
Fluorescence assaysReal-time monitoring of flavinationDistinguish between covalent and non-covalent binding
Genetic knockoutsIdentification of essential flavination factorsMay require specialized bacterial genetic tools
In vitro reconstitutionDirect biochemical mechanismEstablishing proper redox conditions critical

Understanding this mechanism is particularly important given the observation that nqrC shows very low affinity for FMN in the absence of covalent bonding . The fact that the flavin-binding pocket structure results in relatively weak non-covalent binding underscores the importance of the covalent attachment mechanism for proper function of nqrC in the NQR complex.

What analytical techniques are most suitable for monitoring Na+ translocation coupled to nqrC activity?

Monitoring Na+ translocation coupled to nqrC activity requires specialized analytical techniques that can detect ion movement and correlate it with electron transfer events:

  • Direct Na+ Flux Measurements:

    • 22Na+ radioisotope uptake/efflux assays in proteoliposomes

    • Na+-selective electrodes to monitor concentration changes in real-time

    • Atomic absorption spectroscopy for precise Na+ quantification

    • Fluorescent Na+ indicators (e.g., CoroNa Green) for optical monitoring

  • Membrane Potential Measurements:

    • Voltage-sensitive dyes (e.g., oxonol derivatives) to track potential changes

    • Patch-clamp electrophysiology for direct electrical measurements

    • Potentiometric indicators to monitor Δψ during NQR activity

    • Ion-selective field effect transistors (ISFETs) for continuous monitoring

  • Reconstituted Systems:

    • Proteoliposome preparation with purified NQR complex containing nqrC

    • Inverted membrane vesicles for inside-out orientation studies

    • Planar lipid bilayers with incorporated NQR complex

    • Nanodiscs containing single NQR complexes for single-molecule studies

  • Coupled Enzyme Assays:

    • NADH oxidation monitoring (absorbance at 340 nm) coupled to Na+ movement

    • Quinone reduction assays (various wavelengths depending on quinone)

    • Oxygen consumption measurements for terminal oxidase coupling

What emerging technologies might advance our understanding of nqrC structure and function?

Several emerging technologies hold promise for advancing our understanding of nqrC structure and function, potentially resolving current knowledge gaps:

  • Advanced Structural Techniques:

    • Time-resolved X-ray crystallography to capture intermediate states during electron transfer

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Serial femtosecond crystallography at X-ray free-electron lasers to obtain room-temperature structures

    • Integrative structural biology combining multiple data sources for complete NQR modeling

  • Biophysical Innovations:

    • Single-molecule FRET to track conformational changes during electron transfer

    • Magnetic resonance techniques like DEER (double electron-electron resonance) to measure distances within the protein

    • High-speed atomic force microscopy to visualize conformational dynamics

    • Optogenetic control of electron transfer through light-sensitive domains

  • Computational Advancements:

    • AI-based protein structure prediction specifically tuned for membrane proteins

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of electron transfer

    • Markov state modeling of conformational transitions

    • Enhanced sampling techniques for studying rare events in Na+ translocation

  • Chemical Biology Approaches:

    • Unnatural amino acid incorporation for site-specific probes in nqrC

    • Click chemistry for in situ labeling of functional domains

    • Photocaged compounds for temporal control of nqrC activity

    • Genetically encoded sensors for real-time activity monitoring

These emerging technologies will likely enable researchers to build upon current structural knowledge and mechanistic understandings to address unresolved questions about nqrC, particularly regarding the dynamic aspects of its function and its integration within the larger NQR complex and bacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.