Recombinant Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nqrE; nqr5; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Vibrio alginolyticus
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY NLVLRENALVEGVDLSFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESIVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA through NqrE likely participate in the second step: ubisemiquinone conversion to ubiquinol.

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of nqrE within the Na+-NQR complex?

The nqrE subunit is one of six subunits (NqrA-F) that constitute the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) complex. While the entire complex functions as a respiratory enzyme coupling electron transfer to sodium pumping, nqrE specifically contributes to the transmembrane structure of the complex and participates in the ion translocation pathway. Research indicates that nqrE is integral to maintaining the structural integrity necessary for proper sodium transport across the membrane dielectric .

The Na+-NQR complex operates through a series of redox reactions involving multiple cofactors including flavins and a 2Fe-2S center. Within this system, nqrE likely participates in the conformation changes that occur during sodium uptake (when electrons move from the 2Fe-2S center to FMN C) and sodium translocation (when electrons transfer from FMN B to riboflavin) .

How does nqrE differ structurally and functionally from other Na+-NQR subunits?

While the search results don't specifically delineate the unique structural features of nqrE compared to other subunits, we can infer from general Na+-NQR research that each subunit contains distinct functional domains. The NqrE subunit likely contains transmembrane helices that contribute to the sodium translocation channel or pathway, distinguishing it from subunits like NqrF which contains the FAD cofactor and NADH binding site.

What expression systems are most effective for producing recombinant nqrE?

Expression SystemAdvantagesLimitationsYield (approximate)
E. coli BL21(DE3)Rapid growth, cost-effectivePotential improper folding1-3 mg/L culture
E. coli C43(DE3)Improved for membrane proteinsStill may require optimization2-5 mg/L culture
Yeast (P. pastoris)Better folding for complex proteinsLonger expression time5-10 mg/L culture
Insect cellsSuperior folding and PTMsHigher cost, complex protocols2-8 mg/L culture

For optimal results, researchers should employ specialized vectors containing appropriate fusion tags (His6, MBP, or SUMO) that facilitate both expression and subsequent purification while minimizing interference with protein function.

How should experiments be designed to study redox coupling in nqrE?

Designing experiments to study redox coupling involving nqrE requires a multifaceted approach:

  • Mutation Analysis: Create site-directed mutations in conserved residues of nqrE that might participate in sodium binding or translocation, similar to studies performed with NqrB-D346A which affects sodium ejection .

  • Stopped-Flow Kinetics: Employ rapid-mixing techniques to measure electron transfer rates before and after mutation of key residues in nqrE. This approach can reveal how structural changes in nqrE affect the redox reactions in the Na+-NQR complex .

  • Membrane Potential Measurements: Use voltage-sensitive dyes or electrophysiological techniques to measure ΔΨ formation during partial turnover conditions, which can identify the specific redox steps coupled to sodium translocation .

  • Control Experiments: Include parallel experiments with known inhibitors like CoQH₂, which blocks electron flow to riboflavin, to validate the specific role of nqrE in the electron transfer pathway .

A robust experimental design would include both wild-type and mutant forms of nqrE, with measurements under varying sodium concentrations to determine the sodium-dependency of electron transfer rates through the complex.

What are the critical factors to consider when purifying recombinant nqrE for structural studies?

Purification of recombinant nqrE for structural studies requires careful attention to membrane protein handling:

  • Detergent Selection: Test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization while maintaining native structure.

  • Buffer Optimization: Develop buffers containing appropriate sodium concentrations to maintain stability, typically 100-300 mM NaCl.

  • Reducing Environment: Maintain mild reducing conditions (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to preserve any cysteine residues involved in structural integrity.

  • Purification Strategy:

    • Initial capture: IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to ensure monodispersity

  • Quality Control: Assess protein purity using SDS-PAGE, homogeneity via dynamic light scattering, and functionality through activity assays.

For structural studies, protein concentration should be optimized (typically 5-15 mg/mL) and stabilizing additives like glycerol (5-10%) may improve sample integrity during crystallization or cryo-EM grid preparation.

What experimental controls are essential when measuring nqrE contribution to sodium transport?

When measuring nqrE's contribution to sodium transport, several controls are essential:

  • Negative Controls:

    • nqrE deletion mutants to establish baseline activity

    • Sodium-free conditions to confirm Na⁺-dependency

    • Inhibitor controls using compounds that block specific redox steps

  • Positive Controls:

    • Wild-type Na⁺-NQR complex with intact nqrE

    • Complementation of nqrE deletion with wild-type gene

  • Specificity Controls:

    • Test alternative cations (K⁺, Li⁺) to confirm Na⁺ specificity

    • Use ionophores that selectively disrupt Na⁺ gradients (monensin)

  • Methodological Controls:

    • Internal standards for quantification methods

    • Time-course measurements to establish linearity of transport

Similar to studies on NqrB mutants, researchers should measure both enzymatic activity (CoQ reduction) and sodium transport to distinguish between effects on electron transfer versus ion translocation .

How do conformational changes in nqrE coordinate with redox reactions in other Na+-NQR subunits?

The coordination between nqrE conformational changes and redox reactions in other subunits represents a sophisticated research question. Based on research with the Na+-NQR complex, sodium transport involves multiple redox steps across different subunits .

For nqrE specifically, researchers should investigate:

  • Structural Transitions: Using techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or FRET (Förster Resonance Energy Transfer) with strategically placed fluorophores to detect conformational changes in nqrE during different redox states of the complex.

  • Temporal Correlation: Correlating the timing of conformational changes in nqrE with specific redox transitions, particularly the reduction of FMN C (associated with sodium uptake) and the electron transfer from FMN B to riboflavin (associated with sodium translocation) .

  • Cross-linking Studies: Employing chemical cross-linking followed by mass spectrometry to identify transient interactions between nqrE and other subunits during the catalytic cycle.

Research suggests that Na+-NQR operates through a novel mechanism based on kinetic coupling mediated by conformational changes rather than through a single-site thermodynamic coupling model . This implies that nqrE likely participates in a coordinated series of structural changes that facilitate sodium movement through the complex.

What is the molecular mechanism by which mutations in nqrE affect sodium binding versus sodium translocation?

This advanced question requires distinguishing between effects on sodium binding versus translocation, similar to studies performed with NqrB mutations. Based on established research approaches:

  • Comparative Mutation Analysis: Generate mutations in nqrE analogous to the characterized NqrB-D397A (affecting Na⁺ binding) and NqrB-D346A (affecting Na⁺ ejection) to identify functionally equivalent residues .

  • Binding Affinity Measurements: Determine the apparent Km for Na⁺ in wild-type versus mutant forms using steady-state kinetics to identify mutations specifically affecting binding.

  • Electrophysiology: Measure sodium currents across membranes containing wild-type or mutant Na⁺-NQR complexes to identify defects in translocation versus binding.

  • Redox Kinetics Analysis: Analyze the kinetics of reduction and oxidation of cofactors in nqrE mutants compared to wild-type, looking for patterns similar to those observed in NqrB-D346A where electron transfer from FMN B to riboflavin is impaired .

The distinction between binding and translocation can be made by examining whether mutations affect the apparent affinity for sodium (Km Na⁺) versus the sodium sensitivity of the quinone reductase activity, as demonstrated in studies with NqrB mutations .

How do the thermodynamics of redox reactions involving nqrE compare with other energy-transducing membrane proteins?

Comparing the thermodynamics of redox reactions involving nqrE with other energy-transducing proteins provides insights into unique aspects of Na⁺-NQR function:

Energy-Transducing SystemPrimary Energy SourceCoupling IonEfficiency (ATP/e⁻)Key Thermodynamic Features
Na⁺-NQRNADH → Q reductionNa⁺Indirect contribution to PMFRedox-driven conformational coupling
Complex INADH → Q reductionH⁺3-4 H⁺/2e⁻Direct proton pumping
Cytochrome bc₁QH₂ → cytochrome cH⁺2 H⁺/2e⁻Q-cycle with bifurcated electron flow
Na⁺/K⁺-ATPaseATP hydrolysisNa⁺, K⁺3 Na⁺/1 ATPDirect coupling to ATP hydrolysis

Unlike Complex I, which couples electron transfer directly to proton translocation through a series of conformational changes in its membrane domain, Na⁺-NQR appears to operate through a distinct mechanism. Research suggests that Na⁺-NQR employs kinetic coupling rather than thermodynamic coupling, with sodium transport occurring at two separate steps in the electron transfer pathway .

The redox steps involving nqrE would need to be examined for their standard reduction potentials, the free energy changes associated with each electron transfer step, and how these energy changes correlate with the energy required for sodium translocation across the membrane dielectric.

How should researchers interpret discrepancies between in vitro and in vivo nqrE functional studies?

When faced with discrepancies between in vitro and in vivo functional studies of nqrE, researchers should consider:

  • Lipid Environment Effects: The membrane composition in reconstituted systems may differ from native membranes, affecting nqrE structure and function. Systematically test different lipid compositions to identify optimal conditions matching physiological performance.

  • Protein-Protein Interactions: In vivo, nqrE functions within the complete Na⁺-NQR complex and potentially interacts with other cellular components. These interactions may be absent or altered in purified systems.

  • Post-translational Modifications: Check for potential modifications present in vivo but absent in recombinant systems, using mass spectrometry to identify differences.

  • Redox Environment: The cellular redox environment may differ significantly from in vitro conditions, affecting the redox state of cofactors and cysteine residues.

Analysis approach:

  • Create correlation matrices between in vitro and in vivo measurements

  • Develop correction factors based on systematic differences

  • Use mathematical models to account for differences in experimental conditions

A structured approach to reconciling these differences would involve designing hybrid experiments that progressively incorporate in vivo elements into in vitro systems to identify the specific factors responsible for the discrepancies.

What are the most effective protein engineering strategies for studying nqrE structure-function relationships?

Effective protein engineering strategies for nqrE structure-function studies include:

  • Systematic Mutation Approaches:

    • Alanine scanning mutagenesis of conserved residues

    • Charge reversal mutations to probe electrostatic interactions

    • Conservative substitutions to identify essential chemical properties

    • Introduction of cysteine pairs for disulfide cross-linking studies

  • Domain Swapping and Chimeras:

    • Exchange domains between nqrE from different bacterial species

    • Create chimeras with analogous subunits from related enzymes

    • Generate minimal functional constructs to identify essential regions

  • Insertion of Biophysical Probes:

    • Site-specific incorporation of fluorescent amino acids for FRET studies

    • Introduction of paramagnetic probes for EPR distance measurements

    • Incorporation of photocrosslinking groups to capture transient interactions

  • Recombinant Expression Optimization:

    • Codon optimization for expression host

    • Addition of solubility-enhancing fusion partners (removable via protease sites)

    • Incorporation of purification tags at positions verified not to interfere with function

Each engineered variant should be systematically characterized for:

  • Expression levels and solubility

  • Protein stability (thermal shift assays)

  • Cofactor binding (spectroscopic assays)

  • Enzymatic activity (NADH oxidation, quinone reduction)

  • Sodium transport capability

How can advanced spectroscopic techniques be applied to study conformational changes in nqrE during the catalytic cycle?

Advanced spectroscopic techniques provide powerful tools for studying conformational changes in nqrE:

  • Time-Resolved Fluorescence Spectroscopy:

    • Site-specific labeling of nqrE with environmentally sensitive fluorophores

    • Monitoring fluorescence changes during catalytic cycle using stopped-flow apparatus

    • Determining rates of conformational changes relative to electron transfer steps

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping solvent accessibility changes in different redox and sodium-bound states

    • Identifying regions of nqrE that undergo structural rearrangements during catalysis

    • Quantifying the kinetics of conformational changes in different protein regions

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling of strategically placed cysteine residues

    • Double electron-electron resonance (DEER) measurements to determine distances between domains

    • Continuous wave EPR to monitor local environmental changes around spin labels

  • Vibrational Spectroscopy:

    • Fourier-transform infrared (FTIR) difference spectroscopy to detect subtle structural changes

    • Resonance Raman spectroscopy to probe flavin environments and redox states

    • Tip-enhanced Raman spectroscopy for localized measurements at near-atomic resolution

Each spectroscopic approach should be synchronized with the catalytic cycle by using rapid mixing techniques or electrochemical triggering to capture intermediates. Correlation of spectroscopic data with functional measurements, similar to the kinetic analysis performed with Na⁺-NQR variants , would provide a comprehensive understanding of how structural changes in nqrE contribute to sodium transport.

What are the latest cryo-EM approaches for resolving the structure of nqrE within the intact Na+-NQR complex?

The latest cryo-electron microscopy (cryo-EM) approaches for resolving nqrE structure within the intact Na⁺-NQR complex include:

  • Sample Preparation Innovations:

    • Amphipol and nanodisc reconstitution to maintain native-like membrane environment

    • GraFix method (gradient fixation) to stabilize flexible complexes

    • Optimized detergent screening focusing on LMNG, GDN, and novel calixarene-based detergents

    • Strategic use of antibody fragments (Fabs) to increase particle size and provide fiducial markers

  • Data Collection Strategies:

    • Beam-tilt data collection to increase information content

    • Energy-filtered imaging to improve contrast

    • Phase plate technology for enhanced low-resolution features

    • Motion correction algorithms optimized for membrane proteins

  • Processing Advances:

    • 3D variability analysis to capture conformational heterogeneity

    • Neural network-based particle picking optimized for membrane proteins

    • Focused refinement approaches to resolve nqrE specifically within the complex

    • Multi-body refinement to address domain flexibility

  • Functional State Capture:

    • Rapid freezing after initiation of catalytic cycle

    • Trapping of intermediates using inhibitors or substrate analogs

    • Classification approaches to identify different conformational/functional states

To maximize structural insights, cryo-EM should be combined with complementary approaches:

  • Cross-linking mass spectrometry to validate subunit interactions

  • Molecular dynamics simulations to model conformational changes

  • Comparison with structures of related complexes

  • Integration of spectroscopic data for cofactor positioning

Resolution targets should aim for sub-4Å to resolve secondary structure elements and potentially identify coordinated sodium ions, similar to recent achievements with other membrane transport proteins.

How can researchers overcome expression and solubility challenges when working with recombinant nqrE?

Overcoming expression and solubility challenges with recombinant nqrE requires a multi-faceted approach:

  • Expression System Optimization:

    • Test multiple expression hosts: E. coli C41/C43 strains (designed for membrane proteins), Lactococcus lactis, or eukaryotic systems

    • Regulated expression using tunable promoters to prevent toxicity

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

    • Low-temperature induction (16-20°C) to slow protein synthesis and improve folding

  • Construct Design Strategies:

    • N- and C-terminal truncations to remove flexible regions

    • Fusion partners specifically successful with membrane proteins (Mistic, SUMO, MBP)

    • Codon optimization for expression host

    • Removal of rare codons or secondary structure in mRNA

  • Solubilization Approaches:

    • Systematic detergent screening panel:

    Detergent ClassExamplesBest For
    Maltoside-basedDDM, UDMInitial extraction
    Neopentyl glycolLMNG, GDNStability during purification
    Facial amphiphilesSMA copolymerNative lipid retention
    • Detergent concentration optimization (typically 1-2× CMC for solubilization, 2-3× CMC for washing, 1-1.5× CMC for final buffer)

    • Addition of lipids during solubilization (POPC, E. coli polar lipids)

    • Solubilization additives: glycerol (10%), sodium (100-300 mM), and mild reducing agents

  • Stability Enhancement:

    • Disulfide engineering to stabilize tertiary structure

    • Thermostabilizing mutations based on homology modeling

    • Buffer optimization through thermal shift assays

    • Nanobody or Fab fragment co-crystallization partners

For nqrE specifically, expression as part of the complete Na⁺-NQR complex may improve stability and folding compared to isolated subunit expression, as membrane protein subunits often depend on interactions with partner proteins for proper structure.

What approaches can resolve discrepancies in experimental data when studying nqrE function?

When facing discrepancies in experimental data related to nqrE function, researchers should implement a systematic troubleshooting approach:

  • Methodological Variation Analysis:

    • Perform method comparison studies using different techniques to measure the same parameter

    • Standardize protocols across laboratories through detailed standard operating procedures

    • Conduct blind analysis studies to eliminate experimenter bias

  • Sample Preparation Variables:

    • Examine the effects of different purification methods on protein activity

    • Test multiple detergent and lipid compositions

    • Evaluate protein stability over time during experiments

  • Data Integration Strategies:

    • Employ Bayesian statistical approaches to weigh evidence from multiple experiments

    • Develop mathematical models that can accommodate seemingly contradictory data

    • Use meta-analysis techniques to identify patterns across multiple studies

  • Experimental Design Improvements:

    • Increase biological replicates to account for natural variation

    • Include positive and negative controls in every experiment

    • Design experiments with internal validation checks

When addressing specific discrepancies in nqrE research, consider whether the issues might be related to:

  • Incomplete complex assembly when expressing recombinant protein

  • Differences in sodium concentration affecting conformational states

  • Variations in redox state of flavin cofactors

  • Species-specific differences if comparing nqrE from different bacteria

Similar to approaches used in studying the sodium-pumping mechanism of Na⁺-NQR , combining multiple complementary techniques (kinetics, spectroscopy, mutagenesis) provides the most robust way to resolve discrepancies.

How can researchers effectively combine structural and functional studies to elucidate the precise role of nqrE in sodium transport?

Effectively combining structural and functional studies for nqrE research requires:

  • Structure-Informed Functional Studies:

    • Use structural data to identify potential sodium binding sites or transport pathways in nqrE

    • Design targeted mutations of residues identified in structural studies

    • Engineer disulfide bonds to trap specific conformational states predicted by structures

    • Create constructs with fluorescent proteins or tags inserted at structurally informed positions

  • Function-Informed Structural Studies:

    • Capture structures in different functional states using substrate analogs or inhibitors

    • Employ cryo-EM classification to identify conformational states corresponding to different steps in the transport cycle

    • Use functional data to validate and interpret structural models

    • Determine structures of functional mutants to understand structural basis of phenotypes

  • Integrated Experimental Approaches:

    • Molecular dynamics simulations based on structures to predict functional mechanisms

    • In silico docking studies to identify potential sodium binding sites

    • EPR distance measurements to validate structural models in membrane environments

    • Cross-linking mass spectrometry to identify dynamic protein interactions

  • Correlation Analysis Frameworks:

    • Develop quantitative structure-function relationships

    • Create mechanistic models that incorporate both structural and functional data

    • Use machine learning approaches to identify patterns connecting structural features to functional outputs

An example workflow might include:

  • Obtaining cryo-EM structure of Na⁺-NQR complex containing nqrE

  • Identifying conserved residues in nqrE near predicted ion pathways

  • Mutating these residues and measuring effects on sodium transport and redox activities

  • Determining structures of key mutants to observe conformational differences

  • Performing molecular dynamics simulations to model sodium movement through the complex

This integrated approach would build upon findings from previous Na⁺-NQR research showing distinct redox steps coupled to sodium uptake and translocation , providing a comprehensive understanding of nqrE's specific role in this process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.