Recombinant NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Overview of NADH-quinone Oxidoreductase

NQR exists in various forms across different organisms. In Vibrio cholerae, NQR is a six-subunit enzyme that pumps sodium ions . Other organisms, like Saccharomyces cerevisiae, possess a single-subunit NADH dehydrogenase (Ndi1P) that can functionally replace complex I in mammalian cells . Mammalian cells utilize a proton-translocating NADH-ubiquinone oxidoreductase (complex I), dysfunction of which is linked to neurodegenerative disorders .

Structure and Function of NQR Subunits

  • NqrF: This peripheral subunit is the active site for NADH oxidation. It contains one flavin adenine dinucleotide (FAD) and a 2Fe-2S cluster as cofactors and functions as an electron transferase between NADH and subsequent one-electron reaction steps . Studies have successfully produced soluble variants of NqrF (NqrF'), demonstrating high NADH oxidation activity .

  • NqrB and NqrC: These subunits each contain one covalently attached flavin mononucleotide (FMN), which requires the flavin insertase ApbE for its attachment .

  • NqrD and NqrE: These membrane-bound subunits ligate an Fe center within the membrane part of the NQR complex .

Recombinant NQR and its Applications

Recombinant DNA technology allows for the production of NQR and its subunits in various host organisms, such as V. cholerae and Escherichia coli . This capability has facilitated detailed studies on the enzyme's structure, function, and mechanism of action. For example, the entire six-subunit NQR from V. cholerae has been cloned and expressed in V. cholerae, enabling researchers to purify the enzyme and study its properties .

NQR as a Target for Therapeutic Interventions

NQR and related enzymes like NAD(P)H:quinone oxidoreductase 1 (NQO1) have emerged as potential targets for therapeutic interventions in various diseases . For example, NQO1 is a proposed target in pancreatic cancer . Inhibitors of NQO1, such as indolequinones, have been synthesized and evaluated for their ability to inhibit NQO1 activity and cell growth in human pancreatic tumor cells .

NQO1 in Metabolic Syndrome

NQO1 also plays a role in metabolic syndrome . Studies have shown that NQO1 can protect against central adiposity, dyslipidemia, and insulin resistance. Pharmacological activation of NADH oxidation by NQO1 has demonstrated substantial improvement of metabolic syndrome and related phenotypes in murine models .

NQR and Iron Homeostasis

NQR has been shown to impact iron homeostasis in V. cholerae . A proteome analysis revealed that FeoB, the membrane subunit of the uptake system for Fe2+ (Feo), was increased in a V. cholerae Δnqr mutant, suggesting a link between NQR and iron uptake .

Mechanism-based Inhibition of NQO1

Mechanism-based inhibitors of NQO1 are compounds that inhibit the enzyme following catalytic turnover . Indolequinones have been identified as mechanism-based inhibitors of NQO1, with their inhibitory activity dependent on NADH .

NQR and Resistance to Complex I Inhibition

The single-subunit NADH dehydrogenase of Saccharomyces cerevisiae (Ndi1P) can confer resistance to mammalian nerve cells against complex I inhibition . Expression of Ndi1P in dopaminergic cell lines has been shown to protect cells from the toxic effects of complex I inhibitors like rotenone and pyridaben .

Table of Indolequinones and Their NQO1 Inhibition Properties

The table below shows the ability of different indolequinones to function as mechanism-based inhibitors:

No.R3R5R6XMechanism-based inhibitionPartition ratio>90% Inhibition of NQO1 in MIA PaCa-2 cells (nM)IC50 MIA PaCa-2 4 h (nM)IC50 MIA PaCa-2 72 h (nM)
1HOMeHOAr Ar=4-NO2-C6H4yes3.510–100629±17508±5
15HHOmeOAr Ar=4-NO2-C6H4yes3.710–100638±15355±3
5HOMeHOAr Ar=C6H5yes4000nd1385±24962±18
16HHOmeOAr Ar=C6H5yes3800nd4563±26409±30

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Ecok1_21820; APECO1_4277; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Escherichia coli O1:K1 / APEC
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase subunit A) facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in the respiratory chain?

NADH-quinone oxidoreductase subunit A (nuoA) is a transmembrane component of the NADH dehydrogenase complex (also known as Complex I in some organisms) that plays a critical role in the respiratory electron transport chain. In bacteria like Vibrio cholerae, this complex exists as the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR), which contains six subunits (NqrA-F) .

The Na+-NQR functions as a redox-driven sodium pump, catalyzing electron transfer from NADH to ubiquinone while simultaneously translocating Na+ ions across the membrane with a stoichiometry of one Na+ per electron . This process generates a sodium motive force (SMF) that drives energy-consuming processes such as flagellar rotation, substrate uptake, ATP synthesis, and cation-proton antiport .

NuoA specifically contributes to the transmembrane portion of the complex and is involved in the proton translocation machinery. The enzyme shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain .

How does NADH-quinone oxidoreductase differ between prokaryotes and eukaryotes?

The NADH-quinone oxidoreductase shows significant structural and functional differences between prokaryotes and eukaryotes:

FeatureProkaryotic Na+-NQREukaryotic Complex I
Subunit composition6 subunits (NqrA-F)Up to 45 subunits
Ion specificityNa+ in many marine and pathogenic bacteriaH+ in mitochondria
CofactorsFAD, two covalently bound FMNs, riboflavin, Fe-S clustersFAD, FMN, multiple Fe-S clusters
Unique featuresContains riboflavin as cofactor (not reported in other enzymes)More complex architecture
Evolutionary relationshipNo apparent homology to Complex IEvolutionarily related to other NADH dehydrogenases

The Na+-NQR found in bacteria like Vibrio cholerae is relatively simpler compared to the mitochondrial Complex I but performs a similar function in electron transport . The primary distinction is that Na+-NQR specifically translocates Na+ ions, making it particularly important for marine and pathogenic bacteria that use sodium-motive force for energy conservation .

How should experiments be designed to study the electron transfer pathway in NADH-quinone oxidoreductase?

When designing experiments to study electron transfer in NADH-quinone oxidoreductase, researchers should consider the following methodological approaches:

  • Identify independent and dependent variables:

    • Independent variable: Typically the experimental condition being manipulated (e.g., substrate concentration, ion concentration, inhibitor presence)

    • Dependent variable: The measured outcome (e.g., electron transfer rate, enzyme activity)

  • Ultra-fast kinetic measurements:

    • Implement microfluidic stopped-flow instruments with dead times of 0.25 ms or less

    • Collect visible spectra in 50-μs intervals to capture rapid electron transfer events

    • Compare spectra of reaction steps with the spectra of known redox transitions of individual enzyme cofactors

  • Mutational analysis:

    • Create site-directed mutants targeting key residues in the electron transfer pathway

    • Compare kinetic parameters between wild-type and mutant enzymes to identify essential residues

    • Measure activity using both physiological and artificial electron acceptors

  • Inhibitor studies:

    • Use specific inhibitors like HQNO (2-n-heptyl-4-hydroxyquinoline N-oxide) that interact with quinone-binding sites

    • Measure the effect of inhibitors on radical formation and superoxide production

    • Analyze the inhibition mode (competitive, non-competitive, or mixed)

  • Spectroscopic techniques:

    • Employ EPR spectroscopy to detect and characterize radical species

    • Use NMR for studying ligand binding and protein-substrate interactions

    • Implement surface plasmon resonance for dynamic interaction analysis

When implementing these approaches, researchers should ensure at least 5 data points per experimental phase and include appropriate controls to meet standard experimental design criteria .

What controls are necessary when studying recombinant NADH-quinone oxidoreductase subunit A (nuoA)?

Proper controls are critical when studying recombinant nuoA to ensure reliable and interpretable results:

  • Expression system controls:

    • Empty vector control - cells transformed with the expression vector lacking the nuoA gene

    • Wild-type protein control - the native, non-recombinant form of the protein

    • Negative control - cells expressing an unrelated protein using the same expression system

  • Enzyme activity controls:

    • Heat-inactivated enzyme control to establish baseline activity

    • Substrate-free control to measure background reaction rates

    • Inhibitor controls using known NADH-quinone oxidoreductase inhibitors like HQNO

  • Specificity controls:

    • Alternative substrates to confirm substrate specificity

    • Alternative electron acceptors to verify the electron transfer pathway

    • Assays with varying Na+ concentrations to establish ion dependency

  • Mutant controls:

    • Conservative mutations (similar amino acid substitutions) to distinguish between structural and functional effects

    • Complementation experiments where the mutant gene is replaced with the wild-type gene

    • Double mutants to study potential interactions between residues

  • Data validation controls:

    • Interassessor agreement on at least 20% of data points in each experimental phase

    • Measurements by more than one assessor to ensure reliability

    • Multiple technical and biological replicates to establish reproducibility

The controls should be designed to isolate the specific variable being tested while maintaining all other conditions constant across experimental groups .

How should researchers approach contradictory data when studying NADH-quinone oxidoreductase?

When encountering contradictory data in NADH-quinone oxidoreductase research, researchers should follow these methodological steps:

  • Thorough examination of data:

    • Identify specific discrepancies and patterns that contradict the hypothesis

    • Compare findings with existing literature and previous studies

    • Pay special attention to outliers that may influence results

  • Evaluate experimental design and assumptions:

    • Reassess initial assumptions about the enzyme's structure or function

    • Review experimental conditions, particularly Na+ concentration, pH, and temperature

    • Check for technical issues in data collection or analysis methodologies

  • Consider alternative explanations:

    • Develop hypotheses that could explain both the expected and unexpected results

    • Look for previously unrecognized variables that might influence enzyme behavior

    • Consider if contradictions reflect genuine biological complexity rather than errors

  • Refine variables and implement additional controls:

    • Modify experimental conditions to test specific aspects of contradictory results

    • Implement more stringent controls to eliminate potential confounding factors

    • Consider using different analytical techniques to verify observations

  • Embrace contradiction as opportunity:

    • Acknowledge that contradictions in data often lead to novel insights

    • Use mixed methods approaches combining qualitative and quantitative techniques

    • Document all contradictory findings transparently in research reports

As demonstrated in research on Na+-NQR, unexpected findings regarding Na+ dependency of electron transfer rates led to the discovery that the redox step involved in Na+ binding is the reduction of FMN C, which was previously unknown . This example illustrates how contradictory data can lead to significant advances in understanding enzyme mechanisms.

What statistical approaches are most appropriate for analyzing nuoA activity data?

When analyzing nuoA activity data, researchers should select statistical approaches based on experimental design and data characteristics:

  • For kinetic measurements:

    • Non-linear regression for fitting enzyme kinetic models (Michaelis-Menten, Hill equation)

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for linearized kinetic analysis

    • Global fitting for analyzing multiple datasets simultaneously

  • For comparing experimental conditions:

    • ANOVA for comparing multiple experimental groups

    • Student's t-test for comparing two experimental conditions

    • ANCOVA when controlling for covariates that might affect enzyme activity

  • For mutational studies:

    • Multiple regression to analyze relationships between structural changes and activity

    • Correlation analysis to identify associations between specific mutations and kinetic parameters

    • Principal component analysis to identify patterns in multivariate datasets

  • For single-subject experimental designs:

    • Visual analysis of data points across phases

    • Calculation of percentage of non-overlapping data points

    • Randomization tests for establishing experimental control

  • For power analysis and sample size determination:

    • A priori power analysis to determine adequate sample size

    • Post-hoc power analysis to interpret negative results

    • Effect size calculations to quantify the magnitude of observed effects

When reporting statistical results, researchers should include:

  • Effect sizes in addition to p-values

  • Confidence intervals for key parameters

  • Clear specification of the statistical tests used and their assumptions

Researchers should prioritize using appropriate statistical techniques over simple descriptive statistics, especially when comparing complex kinetic parameters between wild-type and mutant enzymes .

How does the structure of NADH-quinone oxidoreductase influence quinone binding and reduction?

The structural features of NADH-quinone oxidoreductase play crucial roles in quinone binding and reduction:

  • Quinone binding site architecture:

    • In Phytophthora capsici QOR (PcQOR), the quinone-binding site is formed by residues R45, Q48, Y54, C147, and T148, which interact with the quinone molecule and position it for reduction

    • The binding pocket contains a hydrophobic cavity connected to the NADPH-binding site, facilitating electron transfer

    • The phenyl ring of quinone stacks against the nicotinamide ring of NADPH, enabling efficient electron transfer

  • Mechanism of quinone reduction:

    • Upon quinone entry into the active pocket, the substrate is positioned by specific side chains and the NADPH nicotinamide ring

    • Electron transfer proceeds once proper stacking occurs between the quinone and nicotinamide

    • Increased hydrophobicity around the positively charged nicotinamide cavity stimulates electron transfer

    • After reduction of the quinone carbonyl group, hydrogen bonds between quinone and protein residues are broken, allowing product release

  • Multiple quinone binding modes:

    • NMR studies of the Na+-NQR from Vibrio cholerae reveal that two quinone analog ligands can bind simultaneously to the NqrA subunit

    • These ligands bind in direct vicinity to each other, as demonstrated by interligand Overhauser effects

    • This spatially close arrangement may enhance catalytic efficiency during electron transfer

  • Subunit interactions in quinone binding:

    • The NqrA subunit of Na+-NQR has been shown to bind one molecule of ubiquinone-8 with high affinity

    • The methoxy groups at the C-2 and C-3 positions of the quinone headgroup are critical determinants of binding affinity

    • Photoactivatable quinone derivatives demonstrate that ubiquinone-8 bound to NqrA occupies a functional site

The understanding of these structural features has led to the proposal that electron transfer in Na+-NQR is initiated by NADH oxidation on subunit NqrF and leads to quinol formation on subunit NqrA , providing a comprehensive model for the enzyme's catalytic mechanism.

What methodologies can be used to investigate the coupling between electron transfer and Na+ translocation in NADH-quinone oxidoreductase?

Investigating the coupling between electron transfer and Na+ translocation requires sophisticated methodological approaches:

  • Real-time kinetics of electron transfer:

    • Ultra-fast microfluidic stopped-flow instruments with dead times of 0.25 ms

    • Collection of visible spectra in 50-μs intervals to determine rate constants

    • Comparison of spectra with known redox transitions of individual cofactors

  • Na+ concentration dependency experiments:

    • Systematic manipulation of Na+ concentrations (e.g., from 20 μM to 25 mM)

    • Measurement of electron transfer rates between specific cofactors

    • Identification of Na+-dependent redox steps that may represent coupling points

  • Site-directed mutagenesis of coupling sites:

    • Creation of mutants targeting residues involved in Na+ binding or translocation

    • Analysis of the impact on both electron transfer and Na+ translocation

    • For example, the NqrB-D397A mutant showed that the redox step involved in Na+ binding is the reduction of FMN C

  • Inhibitor studies combined with spectroscopy:

    • Use of specific inhibitors like HQNO that block electron transfer

    • Measurement of Na+ translocation in the presence of inhibitors

    • Correlation between inhibition of electron transfer and Na+ translocation

  • Advanced spectroscopic techniques:

    • EPR spectroscopy to detect and characterize radical intermediates

    • Saturation transfer difference NMR to study ligand binding

    • Surface plasmon resonance to analyze dynamic interactions

  • Alternating access mechanism investigation:

    • Study of conformational changes using structural methods

    • Analysis of how the Cys4[Fe] center is alternatively exposed to either side of the membrane

    • Investigation of how the [2Fe-2S] cluster of NqrF and the FMN residue of NqrC alternatively approach the Cys4[Fe] center

Research using these methodologies has identified key coupling points, such as the finding that electron transfer from the [2Fe-2S] cluster to the Cys4[Fe] center and subsequent steps are markedly accelerated when Na+ concentration is increased, suggesting coupling of this step with tight Na+ binding to or occlusion by the enzyme .

What expression systems are most effective for producing functional recombinant NADH-quinone oxidoreductase subunits?

Selecting the appropriate expression system is critical for producing functional recombinant NADH-quinone oxidoreductase subunits:

  • Bacterial expression systems:

    • Escherichia coli BL21(DE3) with pET vectors for high-level expression

    • Cell-free expression systems for transmembrane proteins like nuoA

    • Codon-optimized gene sequences to enhance expression in heterologous hosts

  • Expression optimization strategies:

    • Temperature reduction during induction (typically 16-18°C) to enhance proper folding

    • Addition of specific cofactors (FAD, FMN, riboflavin) to the growth medium

    • Co-expression with chaperone proteins to assist with complex assembly

  • Co-expression of multiple subunits:

    • Polycistronic vectors containing multiple subunit genes

    • Dual-plasmid systems with compatible origins of replication

    • Sequential transformation with different antibiotic selection markers

  • Membrane protein considerations:

    • Use of specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Addition of detergents or membrane-mimicking environments during purification

    • Fusion with solubility-enhancing tags such as MBP or SUMO

  • Cofactor incorporation strategies:

    • Co-expression with ApbE flavin transferase for covalent FMN attachment

    • Supplementation with iron and sulfur sources for Fe-S cluster assembly

    • In vitro reconstitution of cofactors post-purification

For the specific case of nuoA, a cell-free expression system has been successfully used to produce the recombinant protein as documented in commercial sources . This approach may be particularly advantageous for this transmembrane protein component of the complex.

What analytical techniques are most informative for studying the structure and function of NADH-quinone oxidoreductase?

A comprehensive study of NADH-quinone oxidoreductase structure and function requires multiple complementary analytical techniques:

  • Spectroscopic techniques:

    • UV-visible spectroscopy for monitoring redox transitions of flavin cofactors

    • Electron Paramagnetic Resonance (EPR) for detecting and characterizing radical species

    • Nuclear Magnetic Resonance (NMR) for studying ligand binding dynamics

    • Fluorescence spectroscopy for monitoring conformational changes and ligand binding

  • Structural determination methods:

    • X-ray crystallography for high-resolution structure determination (as demonstrated for human and mouse QR1 structures at 1.7Å and 2.8Å resolution, respectively)

    • Cryo-electron microscopy for visualizing larger complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Kinetic analysis techniques:

    • Stopped-flow spectroscopy for real-time kinetic measurements

    • Rapid freeze-quench EPR for trapping intermediates

    • Pre-steady-state kinetics to identify individual steps in the reaction mechanism

  • Molecular interaction studies:

    • Surface plasmon resonance for quantifying protein-ligand interactions

    • Saturation transfer difference NMR for mapping binding epitopes

    • Isothermal titration calorimetry for thermodynamic characterization of binding

  • Computational approaches:

    • Molecular dynamics simulations to model conformational changes

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for reaction mechanism studies

    • Docking simulations to predict substrate binding modes

These techniques have been successfully applied to elucidate critical aspects of NADH-quinone oxidoreductase function, such as the identification of ubisemiquinone formation by Na+-NQR as a key step in reactive oxygen species production and the characterization of the quinone-binding site in QOR enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.