Recombinant NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant NADH-Quinone Oxidoreductase Subunit K 1 (nuoK1)

Recombinant NADH-quinone oxidoreductase subunit K 1 (nuoK1) is a membrane-bound protein component of bacterial NADH dehydrogenase I (NDH-1), a respiratory enzyme critical for electron transfer and proton translocation in the electron transport chain. This subunit is part of the membrane sector of NDH-1, which in bacteria typically comprises 14 subunits. The recombinant form is produced via heterologous expression in Escherichia coli and is tagged (e.g., His-tag) for purification .

Role in NDH-1 Complex

NDH-1 shuttles electrons from NADH to quinones, conserving energy via proton pumping. Subunit nuoK1 resides in the membrane sector, working alongside subunits NuoA, H, J, L, M, and N to form the proton-translocating domain . Its structure includes hydrophobic regions for membrane anchoring and interactions with Fe-S clusters or flavins in adjacent subunits .

Electron Transfer Pathway

In bacterial NDH-1, electrons flow through:

  1. NADH → FMN (NuoG subunit)

  2. FMN → Fe-S clusters (NuoB, NuoI)

  3. Fe-S clusters → Quinone (via NuoK1 and membrane subunits) .

nuoK1 bridges the electron transfer from the peripheral Fe-S clusters to the quinone-binding site, ensuring efficient coupling to proton translocation .

Expression and Purification

OrganismTagPurityApplication
Geobacter bemidjiensisN/ACommercial gradeEnzyme activity assays
Streptomyces avermitilisHis-tag>90% (SDS-PAGE)Structural studies, biotechnology
Helicobacter pyloriHis-tagN/AVaccine development, pathogenicity studies

Recombinant nuoK1 is purified using nickel affinity chromatography and lyophilized for storage at -20°C/-80°C .

Activity and Redox Properties

  • Turnover Rate: Recombinant Na⁺-NQR from Vibrio cholerae (which includes homologs of nuoK1) exhibits a turnover number of 720 electrons/s in the presence of Na⁺ .

  • Quinone Binding: Purified Na⁺-NQR retains ~1 ubiquinone per enzyme when solubilized with dodecyl maltoside (DM), critical for catalytic activity .

  • Proton Translocation: Couples 4 H⁺ translocation per 2 electrons transferred, generating a proton gradient for ATP synthesis .

Comparative Analysis

FeaturenuoK1 (Bacterial)Human NQO1
FunctionProton translocationDetoxification of quinones
CofactorsQuinones, Fe-S clustersFAD, no Fe-S clusters
Subunit StructureMultisubunit complexHomodimer (2 subunits)
Disease LinkAntibiotic target (e.g., V. cholerae) Cancer, oxidative stress

Antimicrobial Targets

The Na⁺-NQR complex (including nuoK1 homologs) in pathogens like Vibrio cholerae is a target for novel antibiotics, as its disruption inhibits proton motive force generation .

Biotechnological Applications

  • Bioenergy: Engineered NDH-1 variants for improved biofuel production via enhanced proton translocation .

  • Structural Studies: Recombinant nuoK1 aids in resolving the membrane domain architecture of NDH-1 using cryo-EM or X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: Our standard shipping includes regular blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK1; SAV_4847; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Target Names
nuoK1
Target Protein Sequence
MNPVNYLYLAALLFTIGATGVLIRRNAIVVFMCVELMLNACNLAFVAFSRLHGNLDGQII AFFTMVVAAAEVVVGLAIIVSLFRSRHSASVDDASLMKL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be menaquinone. This process couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches validate the catalytic efficiency of recombinant NQO1 in mitigating oxidative stress?

To assess NQO1’s role in neutralizing oxidative quinones, researchers employ a two-phase enzymatic assay:

  • Cofactor-dependent activity: Measure NADH/NADPH consumption at 340 nm (ε=6.22×103M1cm1\varepsilon = 6.22 \times 10^3 \, \text{M}^{-1}\text{cm}^{-1}) using substrates like menadione or duroquinone .

  • Radical suppression assays: Compare superoxide anion production (via cytochrome c reduction at 550 nm) in systems with/without NQO1 to quantify its antioxidant capacity .

Critical controls:

  • Include catalase to eliminate H2O2\text{H}_2\text{O}_2-mediated artifacts.

  • Validate specificity using dicoumarol (10 μM), a competitive NQO1 inhibitor .

How is recombinant NQO1 expressed and purified for functional studies?

The E. coli-based expression system is standard due to high yield and scalability:

  • Vector design: Use pET vectors with N-terminal 6xHis tags for IMAC purification .

  • Solubility optimization: Induce expression at 18°C with 0.5 mM IPTG to minimize inclusion bodies.

  • Purification steps:

    • Ni-NTA chromatography (elution with 250 mM imidazole).

    • Size-exclusion chromatography (Superdex 200) to isolate the homodimeric form .

Quality validation:

  • SDS-PAGE (31 kDa monomer).

  • Activity ratio (80\geq 80 μmol/min/mg with NADH and menadione) .

What structural biology strategies resolve substrate-binding ambiguities in NQO1?

X-ray crystallography remains the gold standard:

  • Apo vs. holo structures: Compare ligand-free (1.7 Å resolution) and duroquinone-bound (2.5 Å) forms to identify conformational changes .

  • Active site mapping: Mutagenesis of key residues (e.g., Y128, R45, Q48) combined with molecular dynamics simulations reveals dynamic substrate recognition .

Key findings:

  • Tyr-128 undergoes a 4.2 Å shift upon cofactor binding, sealing the catalytic pocket .

  • Arg-45 stabilizes quinone carbonyls via hydrogen bonding, as shown in Phytophthora capsici QOR homologs .

How do researchers reconcile conflicting data on NQO1’s role in p53 regulation?

Contradictions arise from cell type-specific NADH levels and ubiquitin-independent degradation pathways:

FactorPro-Stabilization Evidence Anti-Stabilization Evidence
NADH availability≥100 μM enhances NQO1-p53 binding<50 μM permits 20S proteasome access
Oxidative stressNQO1-p73α complexes resist H2_2O2_2p53Cys275 oxidation disrupts binding

Resolution strategies:

  • Use isogenic cell lines with CRISPR-edited NQO1.

  • Perform time-resolved FRET to quantify NQO1-p53 interaction kinetics under varying redox conditions .

What methodologies elucidate NQO1’s therapeutic potential in diabetic nephropathy?

Integrated in vivo/in vitro models:

  • Animal studies:

    • db/db mice injected with AAV9-NQO1 show reduced albumin/creatinine ratios (UACR: 45% decrease) via NAD+^+/Sirt1 upregulation .

  • Cellular assays:

    • HK-2 cells under high glucose (30 mM) treated with recombinant NQO1 exhibit:

      • 60% ↓ ROS (MitoSOX flow cytometry).

      • 2.1-fold ↑ NAD+^+/NADH (enzymatic cycling assays) .

Mechanistic validation:

  • EX527 (Sirt1 inhibitor) reverses NQO1-mediated apoptosis suppression.

How are discrepancies in NQO1-substrate affinity measurements addressed?

Reported KmK_m variations (e.g., 8–35 μM for menadione) stem from:

  • Assay temperature (25°C vs. 37°C).

  • Cofactor purity (NADH oxidase contamination artificially inflates VmaxV_{max}).

Standardization protocol:

  • Pre-treat NADH with 100 U/mL lactate dehydrogenase to eliminate oxido-reductase contaminants.

  • Use anaerobic cuvettes to prevent O2_2-dependent flavin oxidation.

What advanced techniques characterize NQO1’s role in DNA repair beyond redox cycling?

Cross-disciplinary approaches:

  • Single-molecule imaging: Track NQO1-RAD54 colocalization in U2OS cells after 5 Gy irradiation .

  • ATPase activity assays: NQO1 enhances RAD54’s kcatk_{cat} by 3.2-fold in strand invasion assays .

Functional interplay:
NQO1’s C-terminal domain (residues 200–274) prevents RAD54AP1 sequestration, facilitating homologous recombination repair .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.