Recombinant NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant nuoK2 is a subunit of the membrane-bound NDH-1 complex, which belongs to the proton-pumping NADH dehydrogenase family. Key functions include:

  • Electron transfer: Shuttling electrons from NADH to quinones via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) clusters .

  • Proton translocation: Coupling redox reactions to proton movement (4 H+^+ translocated per 2 electrons transferred) .

  • Structural contribution: Stabilizing the enzyme's interaction with quinones and coordinating Fe-S clusters .

Sources and Expression Systems

Recombinant nuoK2 has been produced in heterologous systems for structural and functional studies. Examples include:

SpeciesUniprot IDExpression HostSequence LengthSupplier/Study
Geobacter bemidjiensisB5EFF3Mammalian cellsPartial (1-102)Cusabio
Rhodopseudomonas palustrisQ6N1Z7Not specifiedFull (1-102)GeneBioSystems
Geobacter sulfurreducensE. coliFullMyBioSource

Catalytic Mechanism

  • Utilizes FMN and Fe-S clusters (e.g., [4Fe-4S]) to mediate electron transfer .

  • Mutagenesis studies on related subunits (e.g., E. coli NuoM) highlight conserved residues critical for quinone binding and proton pumping .

Functional Studies

  • Proton translocation: Demonstrated in Geobacter sulfurreducens, where nuoK2 contributes to energy conservation under anaerobic conditions .

  • Electron transfer kinetics: Disruption of Fe-S cluster-coordinating cysteines in homologous subunits (e.g., E. coli NuoI) impairs electron flow .

Inhibitor Sensitivity

  • Unlike NQO1/NQO2 (quinone reductases), nuoK2 is not inhibited by dicumarol or flavonoids .

Research Gaps and Future Directions

  • Structural data: No high-resolution structures of nuoK2 are available; current models rely on homologous subunits (e.g., E. coli NuoM) .

  • Mechanistic details: The role of specific residues in quinone binding or proton translocation remains uncharacterized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK2; STH2770; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Symbiobacterium thermophilum (strain T / IAM 14863)
Target Names
nuoK2
Target Protein Sequence
MELPIYYPLGLGALLFGLGLWGALTQKNAVRILMFIEIMLNGVNLNLITFSRYYWQTSPE MAARAPILTLFVMTVAAAEASVGLAIILAMVRNRGVVEVDKATLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be menaquinone. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy in a proton gradient.
Database Links

KEGG: sth:STH2770

STRING: 292459.STH2770

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K 2 (nuoK2) and how does it differ from NQO2?

NADH-quinone oxidoreductase subunit K 2 (nuoK2) belongs to the family of oxidoreductase enzymes that catalyze electron transfer reactions in respiratory chains. While both are involved in quinone metabolism, nuoK2 functions specifically as a membrane subunit in complex I of the respiratory chain, whereas NQO2 (NAD(P)H:quinone acceptor oxidoreductase-2) is a cytosolic enzyme that uses dihydronicotinamide riboside (NRH) rather than NAD(P)H as an electron donor. NQO2 catalyzes both two-electron and four-electron reduction reactions of quinones and other substrates, exhibiting resistance to typical inhibitors of DT-diaphorase like dicumarol and phenindone .

What expression systems are recommended for recombinant nuoK2 production?

For recombinant nuoK2 production, bacterial expression systems using Escherichia coli are commonly employed due to their high yield and relative simplicity. Drawing from successful methods used for related oxidoreductases, researchers should consider using expression vectors with strong inducible promoters (such as T7) and appropriate fusion tags to facilitate purification. For membrane proteins like nuoK2, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yield and proper folding. Alternatively, eukaryotic systems may be considered for more complex post-translational modifications, though this comes with increased complexity and potentially lower yields .

What are the common purification strategies for recombinant nuoK2?

Purification of recombinant nuoK2 requires specialized approaches due to its membrane-bound nature. The recommended methodology includes:

  • Membrane fraction isolation: Differential centrifugation following cell lysis

  • Detergent solubilization: Using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Affinity chromatography: Using fusion tags (His-tag, FLAG-tag) for initial capture

  • Size exclusion chromatography: For final polishing and buffer exchange

  • Functional verification: Activity assays to confirm proper folding

This approach can be adapted from methods used for related membrane proteins and oxidoreductases to maintain the structural integrity and functional activity of the target protein .

How can experimental design address the challenges of studying membrane-associated proteins like nuoK2?

Studying membrane-associated proteins like nuoK2 presents unique experimental challenges that require careful research design consideration. An effective experimental approach employs a quasi-experimental design that addresses the protein's native environment while allowing for controlled manipulation. Researchers should implement parallel experimental and control groups to isolate the effect of specific variables on nuoK2 function, even when random assignment isn't possible .

A comprehensive experimental design should include:

  • Pre-solubilization stabilization strategies using amphipathic molecules

  • Multiple detergent screening panels with activity assays at each stage

  • Reconstitution into artificial membrane systems (nanodiscs, liposomes)

  • Real-time monitoring of structural integrity during functional assays

When random assignment is impossible due to technical constraints, matching techniques can be employed to control for confounding variables, though researchers must acknowledge that unobserved variables may still affect outcomes .

What methodological approaches can resolve contradictory findings in nuoK2 activity assays?

When confronted with contradictory findings in nuoK2 activity assays, researchers should implement a systematic troubleshooting approach utilizing both within-group and between-group comparative analyses. This methodological strategy builds on established experimental design principles to isolate variables affecting experimental outcomes .

The recommended resolution framework includes:

  • Internal validation using multiple detection methods for the same parameter

  • Standardization of protein preparation protocols with detailed documentation

  • Implementation of Solomon 4-Group Design to determine if pre-measurements influence outcomes

  • Statistical analysis of variance components to identify sources of data inconsistency

  • Independent replication in different laboratory environments

This structured approach allows researchers to determine whether contradictions stem from methodological variations, biological heterogeneity, or technical artifacts . When properly implemented, this methodology can establish whether observed differences represent true biological phenomena or experimental noise.

How can recombinant antibody technology enhance structural and functional studies of nuoK2?

Recombinant antibody technology offers sophisticated tools for nuoK2 research that surpass conventional antibody limitations. By generating antibodies with cloned nucleic acid coding regions in expression plasmids, researchers gain several methodological advantages for structural and functional studies .

The implementation strategy involves:

  • Developing recombinant antibody fragments (Fabs, ScFVs) targeting specific nuoK2 epitopes

  • Engineering conformation-specific antibodies to capture distinct functional states

  • Creating intrabodies for in-cell tracking of nuoK2 localization and dynamics

  • Employing bispecific antibodies to study protein-protein interactions

This approach provides unambiguous reagent identification through DNA sequencing, reliable expression, and digital archiving that aligns with research transparency and reproducibility standards . Additionally, the ability to engineer these antibodies allows researchers to develop probes that can capture transient conformational states of nuoK2 during catalytic cycles, revealing mechanistic insights that would be impossible with conventional approaches.

What are the optimal conditions for measuring nuoK2 enzymatic activity?

Measuring nuoK2 enzymatic activity requires carefully optimized conditions that maintain protein stability while allowing for sensitive detection of electron transfer reactions. Based on established methodologies for related oxidoreductases, the following protocol is recommended:

ParameterOptimal ConditionConsiderations
pH7.0-7.5Maintain physiological pH to preserve native conformation
Temperature30°CBalance between activity and stability
Buffer50 mM phosphate with 100 mM NaClInclude 5-10% glycerol as stabilizer
Detergent0.01-0.05% DDMCritical for maintaining solubility without denaturation
Electron donorNADH (250-500 μM)Monitor concentration depletion spectrophotometrically
Electron acceptorUbiquinone analogues (50-100 μM)CoQ1 or decylubiquinone typically used
Inhibitor controlsRotenone (5 μM)Establish specificity of measured activity
Detection methodAbsorbance decrease at 340 nmAlternative: coupled colorimetric assays

This methodology draws from established protocols for NADH-dependent oxidoreductases while accommodating the specific requirements of membrane-associated proteins like nuoK2 .

What are the key considerations for designing a recombinant nuoK2 construct for structural studies?

Designing recombinant nuoK2 constructs for structural studies requires strategic planning to maximize expression, stability, and structural integrity. The methodology should address the inherent challenges of membrane protein studies while facilitating structural determination techniques:

  • Sequence optimization:

    • Codon optimization for expression host

    • Removal of rare codons and secondary RNA structures

    • Careful preservation of functionally critical regions

  • Fusion strategies:

    • N-terminal purification tags with precise TEV cleavage sites

    • Thermostabilizing fusion partners (e.g., T4 lysozyme) for crystallography

    • Fluorescent protein fusions for localization studies

  • Construct screening:

    • Systematic truncation series to identify stable core domains

    • Surface entropy reduction mutations for crystallization

    • Cysteine-free or cysteine-modified variants for labeling studies

This methodological approach draws on established recombinant antibody technology principles, where nucleic acid coding regions are systematically optimized and validated through sequencing to ensure reproducibility and functional integrity .

How should researchers approach inconsistent results when comparing native and recombinant nuoK2?

When confronted with inconsistent results between native and recombinant nuoK2, researchers should implement a systematic comparative analysis framework that distinguishes between biologically meaningful differences and technical artifacts. This approach draws on established principles of experimental design and controls .

The recommended analytical methodology includes:

  • Parallel characterization using identical assay conditions

  • Detailed documentation of all expression and purification parameters

  • Implementation of multiple complementary analytical techniques

  • Statistical analysis of variance components across replicate experiments

  • Systematic evaluation of potential post-translational modifications

This methodological approach acknowledges that differences may arise from multiple sources, including conformational variations, lipid environment differences, or post-translational modifications absent in recombinant systems . By systematically testing these hypotheses through controlled experiments, researchers can determine whether observed inconsistencies represent true biological phenomena or technical limitations.

What statistical approaches are most appropriate for analyzing nuoK2 kinetic data?

Analysis of nuoK2 kinetic data requires specialized statistical approaches that account for the complex nature of membrane protein kinetics and potential sources of experimental variability. The recommended statistical methodology incorporates:

  • Non-linear regression analysis for enzyme kinetic parameters:

    • Michaelis-Menten equation fitting for standard kinetics

    • Allosteric models when cooperativity is observed

    • Global fitting approaches for multiple datasets

  • Robust statistical validation:

    • Residual analysis to verify model fit

    • Bootstrap resampling to establish confidence intervals

    • Analysis of covariance (ANCOVA) for comparing kinetic parameters between conditions

  • Addressing membrane protein-specific challenges:

    • Statistical correction for detergent or lipid effects

    • Hierarchical modeling to account for preparation-to-preparation variability

    • Time-dependent analysis to assess stability during measurements

This approach builds on established experimental design principles while recognizing the specific challenges of membrane protein research . Proper statistical analysis is essential for distinguishing true biological effects from experimental artifacts.

How can emerging recombinant technologies advance nuoK2 structure-function studies?

Emerging recombinant technologies offer promising avenues for advancing nuoK2 structure-function studies beyond traditional limitations. Building on recent developments in recombinant antibody technology and protein engineering, researchers can implement innovative approaches :

  • Nanobody-based structural stabilization:

    • Selection of conformation-specific nanobodies (VHH domains)

    • Co-crystallization with nuoK2 to stabilize specific functional states

    • In-cell conformational locking for functional studies

  • Directed evolution strategies:

    • Development of high-expression variants through iterative selection

    • Engineering of thermostable variants for structural studies

    • Creation of activity-enhanced mutations for mechanistic insights

  • Advanced labeling approaches:

    • Site-specific incorporation of unnatural amino acids

    • Click chemistry-based in situ labeling strategies

    • Environmentally sensitive fluorophores at catalytic sites

These methodological innovations build on established recombinant antibody approaches while specifically addressing the challenges of membrane protein research . By employing these cutting-edge techniques, researchers can gain unprecedented insights into the structural dynamics and function of nuoK2.

What are the most promising approaches for studying nuoK2 in its native membrane environment?

Studying nuoK2 in its native membrane environment presents significant challenges that require specialized methodological approaches. Building on recent advances in membrane protein research, the following strategies show particular promise:

  • Advanced membrane mimetic systems:

    • Nanodiscs with defined lipid compositions

    • Polymer-based membrane systems (SMALPs)

    • Native membrane vesicle preparations

  • In situ structural approaches:

    • Cryo-electron tomography of membrane fragments

    • Mass spectrometry of intact membrane complexes

    • Single-particle cryo-EM of membrane protein complexes

  • Functional characterization methodologies:

    • Solid-supported membrane electrophysiology

    • Surface-sensitive techniques (SPR, QCM-D)

    • Single-molecule fluorescence approaches

These approaches represent the cutting edge of membrane protein research methodology, allowing researchers to study nuoK2 while maintaining its native lipid environment and protein-protein interactions . By preserving these critical contexts, researchers can gain insights into nuoK2 function that would be impossible using traditional detergent-solubilized preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.