Recombinant NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Forms

Recombinant nuoK is expressed in E. coli using heterologous systems, often with tags for purification. Variants differ by organism and truncation:

OrganismSourceLengthTagExpression HostPurityReference
Ralstonia pickettiiMyBioSourcePartialN/AE. coliN/A
Helicobacter pyloriCreative Biomart1–100 aaN-terminal HisE. coli>90%
E. coliCusabioFull-lengthN-terminal HisE. coli>90%

Key Production Details:

  • Expression Systems: E. coli BL21(DE3) or similar strains.

  • Purification: Affinity chromatography (e.g., nickel-agarose for His-tagged proteins).

  • Storage: Lyophilized or in Tris/PBS buffer with trehalose at -20°C/-80°C .

Research Findings and Functional Insights

While nuoK’s direct role in proton translocation remains unresolved, studies highlight its association with complex I assembly and stability:

  • Structural Role:

    • Part of the hydrophobic arm that interacts with quinone and proton-translocating subunits (e.g., NuoM, NuoL) .

    • Mutations in related subunits (e.g., NuoM Glu144) abolish proton pumping, suggesting indirect coordination .

  • Biochemical Studies:

    • Recombinant nuoK is used to study complex I assembly and interactions with peripheral subunits (NuoA–NuoN) .

    • No direct evidence links nuoK to proton translocation; its function may be structural or regulatory .

Key Limitations:

  • Limited functional studies focus on nuoK; most research targets larger subunits (e.g., NuoM, NuoL) .

  • Partial truncations (e.g., Ralstonia pickettii variant) may alter activity .

Applications in Research and Industry

Recombinant nuoK serves as a tool for:

  • Structural Biology: Crystallization studies of complex I subunits.

  • Functional Assays: Testing inhibitors (e.g., rotenone) or proton-coupled electron transfer mechanisms.

  • Biotechnology: Engineering complex I variants for biofuel production or ROS modulation .

Example Use Case:

  • Proton Translocation Studies: Mutant strains lacking nuoK could reveal its necessity in complex I assembly or stability .

Comparative Analysis of Recombinant Variants

FeatureRalstonia pickettiiHelicobacter pyloriE. coli
Sequence CoveragePartialFull-length (1–100 aa)Full-length
TagN/AN-terminal HisN-terminal His
PurityN/A>90%>90%
SourceMyBioSourceCreative BiomartCusabio

Future Directions

  • Mechanistic Studies: Investigating nuoK’s interaction with quinone-binding sites or proton channels.

  • Therapeutic Potential: Targeting complex I subunits in metabolic disorders or bacterial infections.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; MAP_3211; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Target Names
nuoK
Target Protein Sequence
MNPINYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDGQMI AFFTMVVAACEVVIGLAIIMTIFRTRKSASVDDANLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is thought to be a menaquinone. It couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the recommended experimental design for characterizing recombinant NADH-quinone oxidoreductase subunit K?

When designing experiments to characterize recombinant NADH-quinone oxidoreductase subunit K (nuoK), researchers should follow a systematic approach similar to that used for other NADH:quinone oxidoreductases. Begin by defining your independent variables (e.g., substrate concentrations, temperature, pH) and dependent variables (e.g., enzymatic activity, binding affinity) .

A robust experimental design should include:

  • Expression and purification validation using SDS-PAGE and Western blotting

  • Enzymatic activity assays with various electron acceptors

  • Kinetic parameter determination (Km, kcat) under different conditions

  • Structural characterization through crystallography or cryo-EM

  • Functional studies in reconstituted systems

Control for extraneous variables such as buffer composition, protein stability, and assay conditions that might influence your results. Include appropriate negative and positive controls for each experimental condition .

How do I determine the optimal expression system for producing functional recombinant nuoK?

The selection of an expression system for nuoK should be guided by several considerations:

  • Membrane protein expression challenges: As nuoK is a membrane-embedded subunit, consider expression systems specialized for membrane proteins such as E. coli C41(DE3) or C43(DE3) strains.

  • Solubility enhancement strategies: Consider fusion tags (MBP, SUMO) that can improve solubility while maintaining function.

  • Experimental validation: Test multiple expression systems in parallel and assess protein yield, purity, and activity. Compare the kinetic parameters with those reported for native complexes.

Unlike cytosolic NADH:quinone oxidoreductases like MmNQO, which can be readily expressed in soluble form, membrane-embedded subunits like nuoK often require specialized approaches . The kinetic parameters of recombinant nuoK preparations should be carefully compared with those of intact complexes to ensure functional integrity.

What are the most reliable methods for measuring nuoK activity within the NADH-quinone oxidoreductase complex?

Measuring nuoK activity within the NADH-quinone oxidoreductase complex requires specific methodological approaches:

Standard activity assays include:

Electron DonorElectron AcceptorDetection MethodTypical Range
NADHCoenzyme Q1Absorbance (340 nm)10-100 μM NADH
NADHDCPIPAbsorbance (600 nm)50-200 μM DCPIP
NADHFerricyanideAbsorbance (420 nm)0.5-2 mM

When measuring nuoK activity specifically:

  • Use inhibitors that selectively target other subunits to isolate nuoK function

  • Design reconstitution experiments with purified components to assess the contribution of nuoK

  • Develop subunit-specific assays that monitor proton translocation across membranes

As observed with other NADH:quinone oxidoreductases, expect considerable variation in kinetic constants depending on the electron acceptor used. For example, MmNQO shows Km values ranging from 17 to 258 μM for different electron acceptors .

How can I investigate the role of nuoK in proton translocation without disrupting the entire complex structure?

Investigating nuoK's role in proton translocation while maintaining complex integrity requires sophisticated methodological approaches:

  • Site-directed mutagenesis: Systematically mutate conserved residues predicted to participate in proton channels. Focus on charged or polar residues within transmembrane domains.

  • Proton translocation assays: Employ pH-sensitive fluorescent probes (ACMA, pyranine) to monitor proton movement in reconstituted proteoliposomes.

  • Partial complex reconstitution: Develop a strategy to create subcomplexes containing nuoK and adjacent subunits to isolate specific functional domains.

  • Computational modeling: Use molecular dynamics simulations to predict proton paths and validate experimental findings.

What approaches resolve contradictory kinetic data when characterizing recombinant nuoK in different experimental systems?

When facing contradictory kinetic data across different experimental systems:

  • Systematic comparison: Create a comprehensive table documenting all experimental conditions, including expression systems, purification methods, assay conditions, and kinetic parameters.

  • Statistical analysis: Apply confirmatory methodological research approaches to determine if differences are statistically significant or artifacts of experimental variation .

  • Identify confounding variables: Examine potential factors that might explain discrepancies:

    • Detergent effects on membrane protein activity

    • Post-translational modifications in different expression systems

    • Multiprotein complex assembly differences

    • Assay-specific artifacts

  • Validation with native complex: Compare recombinant systems with the native complex isolated from the original organism whenever possible.

Remember that kinetic parameters for NADH:quinone oxidoreductases can vary substantially depending on electron acceptors. For example, MmNQO shows Km values for NADH that vary from 17 to 258 μM depending on the electron acceptor used . This inherent variability might explain some contradictory results.

How can molecular dynamics simulations be integrated with experimental data to elucidate nuoK's role in the respiratory chain?

Integrating molecular dynamics (MD) simulations with experimental data provides powerful insights into nuoK function:

  • Structure preparation: Start with available structural data for NADH-quinone oxidoreductase complex or use homology modeling if nuoK-specific structures are unavailable.

  • Simulation setup:

    • Embed the protein in a lipid bilayer that mimics native membrane composition

    • Include explicit water molecules and ions

    • Apply appropriate force fields optimized for membrane proteins

  • Validation with experimental observables:

    • Compare predicted proton pathways with mutagenesis results

    • Validate quinone binding sites with binding assays

    • Correlate predicted conformational changes with spectroscopic data

  • Iterative refinement:

    • Use experimental results to refine simulation parameters

    • Design new experiments based on simulation predictions

This approach follows the principles of confirmatory methodological research, where computational predictions are systematically tested against experimental data to avoid biases and ensure reproducibility .

What are the most effective approaches for troubleshooting low expression yields of recombinant nuoK?

When facing low expression yields of recombinant nuoK:

  • Systematic optimization strategy:

ParameterVariations to TestMonitoring Method
Expression temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blot
Induction conditionsIPTG concentration, induction timeSDS-PAGE, Western blot
Expression strainC41(DE3), C43(DE3), Rosetta, SHuffleComparative yield analysis
Media compositionLB, TB, 2xYT, minimal mediaGrowth curves, final yield
Codon optimizationOptimize for expression hostmRNA levels, protein yield
  • Fusion strategies: Test various fusion partners (MBP, SUMO, Trx) that can enhance membrane protein expression.

  • Cell-free expression systems: Consider specialized cell-free systems optimized for membrane proteins when cellular expression fails.

This approach is similar to troubleshooting the expression of other membrane proteins and complex enzymes. As seen with the cytosolic NADH:quinone oxidoreductase MmNQO, optimizing expression conditions can significantly impact both yield and activity .

How can I distinguish between direct effects of mutations in nuoK versus indirect effects on complex assembly?

Differentiating direct functional effects from assembly defects requires a multi-faceted approach:

  • Assembly analysis:

    • Blue native PAGE to assess complex formation

    • Size exclusion chromatography to determine subunit association

    • Pull-down assays to measure interaction with partner subunits

    • In-cell labeling to monitor assembly kinetics

  • Activity measurements:

    • Measure activity in partially assembled complexes

    • Compare electron transfer and proton pumping activities separately

    • Develop subunit-specific activity assays

  • Structural assessment:

    • Limited proteolysis to probe structural integrity

    • Thermal shift assays to measure stability changes

    • Spectroscopic methods (CD, fluorescence) to detect conformational changes

This methodological framework allows researchers to systematically categorize mutations as primarily affecting function, assembly, or both. Similar approaches have been used to characterize other components of electron transport chains and enzymatic complexes .

What are the best practices for reconciling in vitro biochemical data with in vivo physiological studies of nuoK function?

Reconciling in vitro and in vivo data requires careful methodological considerations:

  • Systematic comparison framework:

    • Document all differences in experimental conditions

    • Identify parameters that cannot be replicated between systems

    • Develop normalized metrics that allow direct comparison

  • Bridging experiments:

    • Design reconstitution systems of increasing complexity

    • Utilize membrane vesicles as intermediate complexity models

    • Develop cell-based assays that isolate nuoK function

  • Physiological contextualization:

    • Measure respiratory chain activity under various growth conditions

    • Correlate enzyme kinetics with growth parameters

    • Develop methods to measure localized pH changes in living cells

  • Statistical validation:

    • Apply confirmatory methodological approaches to determine if differences are statistically significant

    • Control for multiple testing when comparing numerous parameters

    • Develop predictive models that correlate in vitro parameters with in vivo outcomes

This approach follows principles described for confirmatory methodological research, where researchers must carefully control biases and define the context in which results are supposed to hold .

How can cryo-EM techniques be optimized for structural determination of nuoK within the intact NADH-quinone oxidoreductase complex?

Optimizing cryo-EM for nuoK structural determination:

  • Sample preparation optimization:

    • Test different detergents and nanodiscs for complex solubilization

    • Evaluate amphipols and SMALPs for maintaining native lipid environment

    • Optimize protein concentration and buffer composition

  • Data collection strategy:

    • Employ tilted data collection to overcome preferred orientation issues

    • Use energy filters to enhance contrast for membrane regions

    • Implement phase plate technology for improved low-resolution features

  • Processing workflows:

    • Apply focused refinement techniques targeting the nuoK region

    • Utilize multibody refinement to account for conformational heterogeneity

    • Implement 3D variability analysis to capture dynamic states

  • Validation approaches:

    • Cross-validate with complementary structural methods

    • Confirm key features with targeted mutagenesis

    • Correlate structural features with functional measurements

This methodology builds upon approaches used for other membrane protein complexes, adapting them to the specific challenges of the NADH-quinone oxidoreductase complex and its nuoK subunit .

What computational approaches can predict the impact of nuoK mutations on proton translocation efficiency?

Advanced computational approaches for predicting mutation effects include:

Computational ParameterPrediction MethodCorrelation to Function
pKa shiftsPoisson-Boltzmann equationsProton affinity changes
Water wire stabilityMD simulation analysisProton channel integrity
Energy barriersQM/MM calculationsRate-limiting steps
Conformational changesNormal mode analysisCoupling mechanisms
  • Validation strategy:

    • Benchmark against known mutations with characterized effects

    • Test predictions with experimental measurements

    • Refine models based on experimental feedback

This computational framework allows for systematic evaluation of mutation effects before experimental testing, potentially saving significant research resources while generating testable hypotheses about nuoK function .

How can high-throughput mutagenesis approaches be applied to map functional domains within nuoK?

Implementing high-throughput mutagenesis for nuoK functional mapping:

  • Library generation strategies:

    • Site-saturation mutagenesis of conserved residues

    • Scanning mutagenesis across transmembrane domains

    • Domain-swapping with homologous subunits

    • Random mutagenesis with error-prone PCR

  • Selection/screening system design:

    • Growth-based selection in respiratory-deficient backgrounds

    • Activity-based screening using colorimetric assays

    • FACS-based methods using fluorescent probes sensitive to proton gradients

    • Deep sequencing to quantify mutation frequencies before and after selection

  • Data analysis framework:

    • Develop mutation sensitivity scores for each position

    • Generate functional heat maps across the protein sequence

    • Correlate mutational data with structural information

    • Apply machine learning to identify patterns in mutation effects

  • Validation of high-throughput results:

    • Verify key findings with detailed biochemical characterization

    • Cross-validate with complementary structural approaches

    • Test predictions in vivo with genetic complementation

This approach combines the principles of experimental design with high-throughput methodologies to generate comprehensive functional maps of nuoK, following established methodological frameworks for systematic protein characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.