Recombinant NADH-ubiquinone oxidoreductase chain 2 (ND2)

Shipped with Ice Packs
In Stock

Description

Origin and Expression of Recombinant ND2

ND2 is encoded by the mitochondrial genome (MT-ND2) in humans and other eukaryotes. Recombinant ND2 is synthesized using cell-free expression systems or heterologous hosts, often with affinity tags (e.g., Strep Tag) for purification .

SourceExpression SystemPurification TagPurityApplications
MyBioSource Cell-freeNot specifiedNot detailedStructural studies, functional assays
AliCE® Cell-free (CFPS)Strep Tag>70–80%SDS-PAGE, Western blot, ELISA
Human HEK-293 Eukaryotic cellsHis tag>90%Functional studies, binding assays

Recombinant ND2 retains structural fidelity to its native form, enabling studies of Complex I assembly and catalytic mechanisms .

Functional Role in Complex I

ND2 is essential for electron transfer and proton pumping in Complex I. As part of the minimal catalytic core, it interacts with other subunits (e.g., NUAM, NUBM) to form the enzyme’s functional scaffold .

SubunitRole in Complex ISequence Coverage
NUAM (75 kDa)Matrix domain, NADH binding77% (peptide MS)
ND2 (ND2)Membrane domain, proton translocationNot quantified
NUGM (30 kDa)Fe-S cluster binding80% (peptide MS)

Mutations in ND2 are linked to mitochondrial Complex I deficiency, a disorder causing neuromuscular dysfunction and neurodegeneration .

Research Applications

Recombinant ND2 is employed in:

  1. Structural Studies: Cryo-EM and X-ray crystallography to resolve Complex I’s conformational states .

  2. Functional Assays:

    • Electron Transfer Activity: Measuring NADH-to-ubiquinone electron transfer rates .

    • Proton Pumping Efficiency: Assessing ATP synthesis coupling .

  3. Disease Modeling: Investigating pathogenic mutations in ND2 linked to Complex I disorders .

Challenges and Limitations

  • Low Functional Yield: Recombinant ND2 may lack full catalytic activity due to improper folding or missing auxiliary subunits .

  • Post-Translational Modifications: Mitochondrial-encoded ND2 requires proper lipidation and membrane insertion, which are challenging to replicate in vitro .

Comparative Analysis of ND2 vs. NDUFS2

ND2 and NDUFS2 are distinct subunits of Complex I:

ParameterND2NDUFS2 (Nuclear-encoded)
Genomic OriginMitochondrial (MT-ND2)Nuclear (NDUFS2)
FunctionElectron transfer, proton pumpingFe-S cluster binding
Disease AssociationComplex I deficiencyLeber’s optic neuropathy

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
ND2; NAD2; NADH-ubiquinone oxidoreductase chain 2; NADH dehydrogenase subunit 2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Cyanidium caldarium (Red alga)
Target Names
ND2
Target Protein Sequence
PLAGFFSKLFVFTACLQSSLYFLTFIGILLSGITAFYYIQIIKIIYFGRLNFWSIYIPID KSNAVMISITTLLLILFFADNSIFITSNLVSLNIFHFLK
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 2 (ND2) and what is its function?

NADH-ubiquinone oxidoreductase chain 2 (ND2) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that belongs to the minimal assembly required for catalysis. This protein functions primarily in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor for the enzyme . As part of Complex I, ND2 contributes to the larger energy-transducing mechanism that couples electron transfer to proton translocation across the mitochondrial inner membrane, ultimately driving ATP synthesis.

In structural terms, ND2 is a highly hydrophobic membrane protein that contains multiple transmembrane domains. The protein typically has a molecular mass around 37-39 kDa, with the specific mass varying slightly between species (e.g., 37.8 kDa in Oncorhynchus mykiss) . ND2's integration into the membrane domain of Complex I positions it to potentially participate in the conformational changes that drive proton pumping.

How is recombinant ND2 typically expressed and purified for research applications?

Recombinant expression of ND2 presents significant challenges due to its highly hydrophobic nature and membrane integration requirements. Successful expression protocols typically involve:

  • Selection of appropriate expression systems:

    • Bacterial systems (E. coli) with specialized strains designed for membrane protein expression

    • Insect cell expression systems (Sf9, High Five) which better accommodate complex membrane proteins

    • Cell-free expression systems that can directly incorporate membrane proteins into artificial lipid environments

  • Optimization strategies:

    • Use of fusion tags to improve solubility (MBP, SUMO, etc.)

    • Codon optimization for the expression host

    • Controlled induction at lower temperatures (16-20°C)

    • Co-expression with chaperones to aid proper folding

For purification, researchers typically employ detergent solubilization (using mild detergents such as DDM, LMNG, or digitonin) followed by affinity chromatography based on fusion tags . Subsequent purification often includes size exclusion chromatography to ensure homogeneity. The protein is typically stored in a stabilizing buffer containing glycerol (e.g., Tris-based buffer with 50% glycerol) to maintain structure and function during storage at -20°C or -80°C .

What are the common methods for verifying the structural integrity of purified recombinant ND2?

Multiple complementary techniques are recommended to verify structural integrity:

  • SDS-PAGE and Western blotting: Confirms expected molecular weight and immunoreactivity

  • Circular Dichroism (CD) spectroscopy: Assesses secondary structure composition

  • Tryptophan fluorescence spectroscopy: Monitors tertiary structure integrity

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state

  • Limited proteolysis: Identifies properly folded domains resistant to digestion

  • Activity assays: Functional confirmation (electron transfer capability)

Reconstitution experiments into proteoliposomes or nanodiscs can provide additional evidence of proper folding by demonstrating insertion into membrane-like environments. Mass spectrometry methods (native MS or hydrogen-deuterium exchange MS) offer higher-resolution structural information when available.

How do researchers distinguish between specific and non-specific inhibition when studying ND2 function within Complex I?

Distinguishing between specific and non-specific inhibition of Complex I activity presents a significant challenge in ND2 research. Researchers employ multiple approaches to address this issue:

  • Comparative inhibitor studies: Complex I has well-characterized inhibitors with known binding sites, including rotenone and piericidin A. The differential sensitivity to these inhibitors helps distinguish between specific (energy-transducing) and non-specific pathways. For example, research has shown that inhibitor-insensitive ubiquinone reduction occurs by a ping-pong type mechanism catalyzed by the flavin mononucleotide cofactor in the active site for NADH oxidation .

  • Site-directed mutagenesis: By systematically mutating residues in ND2 and other Complex I subunits, researchers can identify amino acids critical for inhibitor binding versus catalytic function.

  • Quantitative inhibition analysis: Researchers track inhibitor sensitivity ratios at various substrate concentrations. For ubiquinone analogues, different sensitivities have been reported:

Ubiquinone AnalogueRotenone Sensitivity (%)Reference
Q₀72-77%
Q₁89-96%
DQ (Decylubiquinone)94-99%
IDE (Idebenone)63%

This variation in inhibitor sensitivity reflects the different apparent Kₘ values of distinct quinone binding sites and helps differentiate between specific energy-transducing pathways and non-specific redox reactions .

  • Spectroscopic monitoring: Using techniques such as electron paramagnetic resonance (EPR) to detect formation of semiquinone intermediates, which can indicate whether electron transfer occurs through the physiological path or alternative routes.

What experimental approaches can resolve the dual electron pathways in recombinant ND2 studies?

Resolving the dual electron pathways (energy-transducing vs. non-energy-transducing) in Complex I involves sophisticated experimental designs:

  • Coupled enzyme assays that monitor:

    • NADH oxidation (spectrophotometric assays at 340 nm)

    • Ubiquinone reduction (changes in absorbance at 275-290 nm)

    • Proton translocation (pH indicators or proton-sensitive fluorescent dyes)

    • Membrane potential (potential-sensitive dyes)

  • Oxygen consumption measurements using:

    • Clark-type electrodes

    • Optical sensors

    • Membrane inlet mass spectrometry

  • Reactive oxygen species (ROS) detection to identify off-pathway electron leakage:

    • Amplex Red assays for H₂O₂ detection

    • Cytochrome c reduction assays for superoxide detection

Experimental data shows distinct patterns of ROS production depending on the ubiquinone analogue used:

UbiquinoneH₂O₂ Formation (nmol min⁻¹ mg⁻¹)Cytochrome c Reduction (nmol min⁻¹ mg⁻¹)
DQ33.9 ± 0.148.4 ± 3.3
Q₁303.8 ± 21.0532.0 ± 32.6
Q₀29.7 ± 3.2276.8 ± 5.0
IDE119.7 ± 1.3432.7 ± 3.0

These values were obtained under specific conditions: presence of asolectin, absence of rotenone, presence of O₂, and absence of catalase or SOD . The substantially higher ROS production with Q₁ and IDE suggests these ubiquinone analogues promote electron leakage through the flavin site rather than the energy-transducing pathway.

  • Reconstitution experiments comparing:

    • Isolated recombinant ND2

    • Partially assembled Complex I subcomplexes

    • Fully assembled Complex I

  • Computational modeling and simulation to predict electron flow pathways based on structural data and experimental constraints.

How can researchers address the challenges of studying hydrophobic ubiquinone interactions with recombinant ND2?

Studying interactions between hydrophobic ubiquinones and ND2 presents significant methodological challenges that researchers address through:

  • Substrate modification approaches:

    • Use of hydrophilic ubiquinone analogues (Q₀, Q₁) while acknowledging their limitations

    • Development of photoaffinity-labeled ubiquinone derivatives that can covalently crosslink to binding sites

    • Fluorescent or spin-labeled ubiquinone derivatives for binding studies

  • Membrane mimetic systems:

    • Nanodiscs with defined lipid compositions

    • Amphipols and other membrane-mimetic polymers

    • Lipid cubic phases for structural studies

    • GUVs (Giant Unilamellar Vesicles) for functional studies with native-like membrane environments

  • Advanced biophysical techniques:

    • Microscale thermophoresis for binding affinity measurements

    • Surface plasmon resonance adapted for membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cryo-electron microscopy to visualize ubiquinone binding sites

  • Quantitative analysis of substrate kinetics:

    • Determination of apparent Kₘ values for different ubiquinone analogues

    • Analysis of inhibition patterns

    • Comparison of kinetics in different membrane environments

When interpreting results, researchers must carefully consider that hydrophilic ubiquinone analogues can lead to reactions through alternative pathways. As demonstrated in past research, inhibitor-insensitive ubiquinone reduction occurs by a ping-pong type mechanism catalyzed by the flavin mononucleotide cofactor, while the physiologically relevant reaction occurs at the energy-transducing site .

What are the methodological considerations for studying ND2's role in reactive oxygen species (ROS) generation?

Accurate assessment of ND2's contribution to ROS production requires careful experimental design:

  • Selection of appropriate detection systems:

    • Amplex Red/horseradish peroxidase system for H₂O₂ detection

    • Cytochrome c reduction assays for superoxide detection

    • Spin trapping combined with EPR spectroscopy for direct radical detection

    • Genetically encoded redox sensors for intracellular studies

  • Controls to distinguish ROS sources:

    • Specific inhibitors of different respiratory complexes

    • Antioxidant enzymes (catalase, SOD) to confirm ROS identity

    • Anaerobic conditions to eliminate O₂-dependent reactions

  • Consideration of experimental variables that affect ROS production:

Experimental ConditionEffect on ROS ProductionMechanism
Presence of asolectinCan reduce H₂O₂ formation with some substratesAlters quinone/semiquinone stability
Presence of rotenoneVariable effects depending on substrateBlocks energy-transducing site but not flavin site
Oxygen concentrationLinear relationship with ROS productionRequired for superoxide formation
Substrate concentrationComplex relationshipAffects steady-state levels of reduced flavin

Research has shown that semiquinones produced at the flavin site can initiate redox cycling reactions with molecular oxygen, producing superoxide radicals and hydrogen peroxide, while regenerating the ubiquinone reactant . This makes the NADH:Q reaction superstoichiometric under certain conditions.

  • Quantitative framework for analysis:

    • Rate comparisons between one-electron (superoxide) and two-electron (H₂O₂) processes

    • Mathematical modeling of electron flux distribution

    • Consideration of dismutation reactions

How does species variation in ND2 sequence affect structure-function studies?

ND2 sequence variations across species present both challenges and opportunities for structure-function analysis:

  • Sequence alignment strategies:

    • Multiple sequence alignment of ND2 from diverse species

    • Identification of conserved functional domains versus variable regions

    • Correlation of sequence variations with known functional differences

  • Comparative expression systems:

    • Expression of ND2 from different species (e.g., Caenorhabditis briggsae, Oncorhynchus mykiss) to identify which express better

    • Creation of chimeric constructs combining stable regions from one species with functional regions from another

    • Site-directed mutagenesis to introduce species-specific residues

  • Functional characterization across species:

    • Enzymatic activity assays under standardized conditions

    • Inhibitor sensitivity profiles

    • Thermal stability comparisons

    • ROS production tendencies

  • Structural biology approaches:

    • Comparative modeling based on available structures

    • Identification of species-specific structural features

    • Analysis of co-evolution patterns to identify functionally coupled residues

Researchers should be particularly attentive to differences in key functional regions, such as ubiquinone binding sites, membrane-embedded segments, and interfaces with other Complex I subunits. The complete amino acid sequences from different species, such as those available for Caenorhabditis briggsae (Uniprot: Q8HEC1) and Oncorhynchus mykiss, provide valuable starting points for such comparisons .

How can recombinant ND2 be utilized in drug development for mitochondrial disorders?

Recombinant ND2 offers several strategic applications in drug discovery for mitochondrial disorders:

  • High-throughput screening platforms:

    • Development of activity-based assays suitable for compound library screening

    • Fluorescence-based binding assays to identify direct ND2 interactors

    • Cell-based phenotypic screens utilizing ND2 mutants or knockdowns

  • Structural biology approaches:

    • Cryo-EM and X-ray crystallography of ND2 alone or within Complex I

    • Structure-based virtual screening and drug design

    • Fragment-based drug discovery targeting ND2 binding pockets

  • Therapeutic strategies targeting ND2:

    • Development of ubiquinone analogues with improved specificity

    • Design of compounds that enhance native ND2 activity or stability

    • Exploration of allosteric modulators that could reduce ROS production

  • Disease-specific applications:

    • Modeling disease-associated ND2 mutations in recombinant systems

    • Drug screening against disease-specific ND2 variants

    • Development of mutation-specific therapeutic approaches

Idebenone, an artificial ubiquinone that shows promise in treating Friedreich's Ataxia, represents an example of a therapeutic compound that interacts with Complex I, though research indicates it reacts at the flavin site rather than through the energy-transducing pathway . This highlights both the potential and the complexity of targeting ND2/Complex I for therapeutic development.

What analytical techniques can resolve contradictory findings in ND2 research?

When faced with contradictory results, researchers can employ several strategies:

  • Standardization of experimental conditions:

    • Careful control of pH, temperature, ionic strength, and detergent concentration

    • Consistent protein preparation protocols

    • Standardized activity assay conditions

    • Use of common reference standards

  • Multi-technique approach to verify findings:

    • Orthogonal assay methods for the same parameter

    • Comparison of in vitro versus cellular/in vivo results

    • Use of both direct and indirect measurement approaches

  • Resolution of redox chemistry complexities:

    • Detailed examination of electron transfer pathways

    • Careful discrimination between specific and non-specific reactions

    • Accounting for potential side reactions and artifacts

  • Advanced data analysis:

    • Statistical meta-analysis of multiple studies

    • Bayesian approaches to model uncertainty

    • Machine learning methods to identify patterns across datasets

  • Collaborative validation:

    • Round-robin testing across different laboratories

    • Development of consensus protocols

    • Pre-registered replication studies

For example, contradictions in inhibitor sensitivity measurements for ubiquinone analogues can often be resolved by carefully controlling membrane/phospholipid content, oxygen levels, and specific detection systems as demonstrated in previous research comparing resorufin formation and cytochrome c reduction under various experimental conditions .

How can researchers distinguish between functional effects of ND2 versus other Complex I subunits?

Isolating ND2-specific functions from those of other Complex I subunits requires sophisticated experimental designs:

  • Genetic approaches:

    • Site-directed mutagenesis targeting ND2-specific residues

    • CRISPR/Cas9 genome editing to create specific ND2 variants

    • RNA interference or antisense approaches for selective knockdown

    • Complementation studies in ND2-deficient systems

  • Reconstitution strategies:

    • Bottom-up assembly of Complex I from purified components

    • Selective incorporation of wild-type or mutant ND2 into subcomplexes

    • Comparison of properties before and after ND2 incorporation

  • Structural biology techniques:

    • Crosslinking studies to map ND2 interaction partners

    • Hydrogen-deuterium exchange to identify conformational changes

    • Cryo-EM analysis of ND2 positioning within Complex I

  • Computational approaches:

    • Molecular dynamics simulations of ND2 within Complex I

    • In silico mutagenesis and energy calculations

    • Protein-protein interaction network analysis

  • Comparative analysis across species:

    • Utilization of natural variations in ND2 versus other subunits

    • Correlation of sequence differences with functional variations

    • Creation of chimeric complexes with subunits from different species

Research distinguishing between the energy-transducing pathway (involving multiple Complex I subunits) and the non-energy-transducing pathway (primarily involving the flavin site) provides a model for separating subunit-specific functions through careful inhibitor studies and kinetic analysis .

What are the emerging techniques for studying recombinant ND2 in membrane environments?

Recent methodological advances have expanded options for studying ND2 in near-native conditions:

  • Advanced membrane mimetic systems:

    • Nanodiscs with defined lipid compositions

    • Native nanodiscs extracted directly from mitochondrial membranes

    • Lipodisqs and styrene-maleic acid lipid particles (SMALPs)

    • Microfluidic platforms for membrane protein reconstitution

  • Single-molecule techniques:

    • Atomic force microscopy for topography and mechanical properties

    • Single-molecule FRET to monitor conformational changes

    • Optical tweezers for measuring force generation

    • Planar lipid bilayer electrophysiology

  • Advanced imaging approaches:

    • Super-resolution microscopy (STORM, PALM, STED)

    • Correlative light and electron microscopy (CLEM)

    • Cryo-electron tomography of membrane-embedded complexes

    • 4D cryo-EM (time-resolved structural studies)

  • Label-free detection methods:

    • Surface-enhanced infrared absorption spectroscopy

    • Nanoplasmonic sensing

    • Quartz crystal microbalance with dissipation monitoring

    • Microfluidic respirometry

These emerging techniques help address long-standing challenges in studying membrane proteins like ND2, particularly regarding maintenance of native structure and function outside the mitochondrial membrane environment. They offer new opportunities to understand how lipid composition and membrane properties influence ND2 function within Complex I.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.